Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 341026..341248 | Replicon | chromosome |
Accession | NZ_CP023388 | ||
Organism | Escherichia coli strain 1105 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | CNQ47_RS01795 | Protein ID | WP_001295224.1 |
Coordinates | 341141..341248 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 341026..341084 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ47_RS01765 | 336467..337369 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
CNQ47_RS01770 | 337380..338363 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
CNQ47_RS01775 | 338360..339364 | + | 1005 | WP_000107018.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CNQ47_RS01780 | 339394..340665 | - | 1272 | WP_001313380.1 | amino acid permease | - |
- | 341026..341084 | - | 59 | - | - | Antitoxin |
CNQ47_RS01795 | 341141..341248 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
CNQ47_RS01800 | 341334..343013 | - | 1680 | WP_000191568.1 | cellulose biosynthesis protein BcsG | - |
CNQ47_RS01805 | 343010..343201 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CNQ47_RS01810 | 343198..344769 | - | 1572 | WP_077633450.1 | cellulose biosynthesis protein BcsE | - |
CNQ47_RS01815 | 345042..345230 | + | 189 | WP_001063314.1 | YhjR family protein | - |
CNQ47_RS01820 | 345242..345994 | + | 753 | WP_000279525.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T81132 WP_001295224.1 NZ_CP023388:341141-341248 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T81132 NZ_CP023388:341141-341248 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT81132 NZ_CP023388:c341084-341026 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|