Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 31629..31893 | Replicon | plasmid p96 |
Accession | NZ_CP023370 | ||
Organism | Escherichia coli strain 1428 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | CNQ52_RS27165 | Protein ID | WP_001387489.1 |
Coordinates | 31741..31893 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 31629..31689 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ52_RS27140 | 26701..27909 | - | 1209 | WP_011264049.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 28089..28146 | - | 58 | NuclAT_1 | - | - |
- | 28089..28146 | - | 58 | NuclAT_1 | - | - |
- | 28089..28146 | - | 58 | NuclAT_1 | - | - |
- | 28089..28146 | - | 58 | NuclAT_1 | - | - |
CNQ52_RS27145 | 28216..28965 | - | 750 | Protein_35 | protein finQ | - |
CNQ52_RS27150 | 29194..29511 | + | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
CNQ52_RS27155 | 29508..30041 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
CNQ52_RS27160 | 30135..31280 | - | 1146 | WP_000976514.1 | class C beta-lactamase CMY-2 | - |
- | 31629..31689 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 31629..31689 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 31629..31689 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 31629..31689 | - | 61 | NuclAT_0 | - | Antitoxin |
CNQ52_RS27165 | 31741..31893 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
CNQ52_RS27170 | 31965..32216 | - | 252 | WP_001291964.1 | hypothetical protein | - |
CNQ52_RS27175 | 32516..32812 | + | 297 | WP_011264046.1 | hypothetical protein | - |
CNQ52_RS28110 | 32877..33053 | - | 177 | WP_001054897.1 | hypothetical protein | - |
CNQ52_RS27180 | 33445..33654 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CNQ52_RS27185 | 33726..34388 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CNQ52_RS27190 | 34459..36627 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-2 | - | 1..96402 | 96402 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T80990 WP_001387489.1 NZ_CP023370:31741-31893 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T80990 NZ_CP023370:31741-31893 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT80990 NZ_CP023370:c31689-31629 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|