Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 219667..219889 | Replicon | chromosome |
Accession | NZ_CP023357 | ||
Organism | Escherichia coli strain 317 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | CNQ55_RS01080 | Protein ID | WP_001295224.1 |
Coordinates | 219782..219889 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 219667..219733 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ55_RS01050 | 215108..216010 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
CNQ55_RS01055 | 216021..217004 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
CNQ55_RS01060 | 217001..218005 | + | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CNQ55_RS01065 | 218035..219306 | - | 1272 | WP_001298005.1 | amino acid permease | - |
- | 219667..219733 | - | 67 | - | - | Antitoxin |
CNQ55_RS01080 | 219782..219889 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
CNQ55_RS01085 | 219976..221655 | - | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
CNQ55_RS01090 | 221652..221843 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CNQ55_RS01095 | 221840..223411 | - | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
CNQ55_RS01100 | 223684..223872 | + | 189 | WP_001063314.1 | YhjR family protein | - |
CNQ55_RS01105 | 223884..224636 | + | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T80865 WP_001295224.1 NZ_CP023357:219782-219889 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T80865 NZ_CP023357:219782-219889 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT80865 NZ_CP023357:c219733-219667 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|