Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 71388..71641 | Replicon | plasmid p72 |
| Accession | NZ_CP023355 | ||
| Organism | Escherichia coli strain 746 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | CNQ56_RS26885 | Protein ID | WP_001312851.1 |
| Coordinates | 71492..71641 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 71388..71444 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CNQ56_RS26845 | 67883..68638 | + | 756 | Protein_85 | conjugal transfer pilus acetylase TraX | - |
| CNQ56_RS26850 | 68695..69250 | + | 556 | Protein_86 | fertility inhibition protein FinO | - |
| CNQ56_RS26855 | 69393..69612 | + | 220 | Protein_87 | hypothetical protein | - |
| CNQ56_RS26860 | 69859..70321 | + | 463 | Protein_88 | thermonuclease family protein | - |
| CNQ56_RS26865 | 70396..70583 | + | 188 | Protein_89 | hemolysin expression modulator Hha | - |
| CNQ56_RS26870 | 70623..71213 | + | 591 | WP_096035224.1 | DUF2726 domain-containing protein | - |
| - | 71388..71444 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 71388..71444 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 71388..71444 | - | 57 | NuclAT_1 | - | Antitoxin |
| - | 71388..71444 | - | 57 | NuclAT_1 | - | Antitoxin |
| CNQ56_RS26885 | 71492..71641 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CNQ56_RS26890 | 71925..72182 | + | 258 | WP_000083826.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..72470 | 72470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T80859 WP_001312851.1 NZ_CP023355:71492-71641 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T80859 NZ_CP023355:71492-71641 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT80859 NZ_CP023355:c71444-71388 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|