Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 27607..27877 | Replicon | plasmid p72 |
Accession | NZ_CP023355 | ||
Organism | Escherichia coli strain 746 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CNQ56_RS26565 | Protein ID | WP_001312861.1 |
Coordinates | 27719..27877 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 27607..27670 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ56_RS28120 | 23335..23453 | + | 119 | Protein_32 | single-stranded DNA-binding protein | - |
CNQ56_RS26525 | 23483..23842 | + | 360 | Protein_33 | single-stranded DNA-binding protein | - |
CNQ56_RS26530 | 23949..24188 | + | 240 | WP_096035201.1 | DUF905 family protein | - |
CNQ56_RS26545 | 24255..26210 | + | 1956 | Protein_35 | ParB/RepB/Spo0J family partition protein | - |
CNQ56_RS26550 | 26284..26723 | + | 440 | Protein_36 | conjugation system SOS inhibitor PsiB | - |
CNQ56_RS26555 | 26720..27439 | + | 720 | WP_096035202.1 | plasmid SOS inhibition protein A | - |
CNQ56_RS26560 | 27451..27639 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 27451..27675 | + | 225 | NuclAT_0 | - | - |
- | 27451..27675 | + | 225 | NuclAT_0 | - | - |
- | 27451..27675 | + | 225 | NuclAT_0 | - | - |
- | 27451..27675 | + | 225 | NuclAT_0 | - | - |
- | 27607..27670 | - | 64 | - | - | Antitoxin |
CNQ56_RS26565 | 27719..27877 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CNQ56_RS28125 | 28568..28774 | + | 207 | WP_000275856.1 | hypothetical protein | - |
CNQ56_RS26580 | 28798..29100 | + | 303 | WP_001272235.1 | hypothetical protein | - |
CNQ56_RS26590 | 29256..29543 | + | 288 | WP_000107542.1 | hypothetical protein | - |
CNQ56_RS26595 | 29662..30483 | + | 822 | WP_157739658.1 | DUF945 domain-containing protein | - |
CNQ56_RS26600 | 30780..31382 | - | 603 | WP_096035204.1 | transglycosylase SLT domain-containing protein | - |
CNQ56_RS26610 | 31705..32088 | + | 384 | WP_096035227.1 | relaxosome protein TraM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..72470 | 72470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T80855 WP_001312861.1 NZ_CP023355:27719-27877 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T80855 NZ_CP023355:27719-27877 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT80855 NZ_CP023355:c27670-27607 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|