Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 95790..96054 | Replicon | plasmid unnamed1 |
Accession | NZ_CP023350 | ||
Organism | Escherichia coli strain ETEC-2264 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | - |
Locus tag | CJU63_RS26425 | Protein ID | WP_001704300.1 |
Coordinates | 95790..95942 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 95992..96054 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJU63_RS26400 | 91272..93440 | + | 2169 | WP_001388820.1 | IncI1-type conjugal transfer membrane protein TraY | - |
CJU63_RS26405 | 93516..94114 | + | 599 | Protein_103 | plasmid IncI1-type surface exclusion protein ExcA | - |
CJU63_RS26410 | 94212..94421 | + | 210 | WP_000416064.1 | hemolysin expression modulator Hha | - |
CJU63_RS27990 | 94630..94806 | + | 177 | WP_001054897.1 | hypothetical protein | - |
CJU63_RS26415 | 94871..95167 | - | 297 | WP_001275298.1 | hypothetical protein | - |
CJU63_RS26420 | 95467..95718 | + | 252 | WP_001291963.1 | hypothetical protein | - |
CJU63_RS26425 | 95790..95942 | - | 153 | WP_001704300.1 | Hok/Gef family protein | Toxin |
- | 95992..96054 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 95992..96054 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 95992..96054 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 95992..96054 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 96295..96350 | + | 56 | NuclAT_1 | - | - |
- | 96295..96350 | + | 56 | NuclAT_1 | - | - |
- | 96295..96350 | + | 56 | NuclAT_1 | - | - |
- | 96295..96350 | + | 56 | NuclAT_1 | - | - |
CJU63_RS26430 | 96511..97497 | + | 987 | WP_000987364.1 | hypothetical protein | - |
CJU63_RS26435 | 97714..98922 | + | 1209 | WP_001388819.1 | IncI1-type conjugal transfer protein TrbA | - |
CJU63_RS26440 | 98941..100011 | + | 1071 | WP_000151586.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | eltA / eltB / csvA | 1..112045 | 112045 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5809.14 Da Isoelectric Point: 8.7948
>T80819 WP_001704300.1 NZ_CP023350:c95942-95790 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVFVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVFVATLAYEVKR
Download Length: 153 bp
>T80819 NZ_CP023350:c95942-95790 [Escherichia coli]
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGTTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGTTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT80819 NZ_CP023350:95992-96054 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|