Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1367394..1367615 Replicon chromosome
Accession NZ_CP023346
Organism Escherichia coli strain ETEC-2265

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag CJU64_RS07080 Protein ID WP_000170954.1
Coordinates 1367394..1367501 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1367549..1367615 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CJU64_RS07055 1363238..1364320 + 1083 WP_000804726.1 peptide chain release factor 1 -
CJU64_RS07060 1364320..1365153 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
CJU64_RS07065 1365150..1365542 + 393 WP_000200392.1 invasion regulator SirB2 -
CJU64_RS07070 1365546..1366355 + 810 WP_001257044.1 invasion regulator SirB1 -
CJU64_RS07075 1366391..1367245 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CJU64_RS07080 1367394..1367501 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1367549..1367615 + 67 NuclAT_28 - Antitoxin
- 1367549..1367615 + 67 NuclAT_28 - Antitoxin
- 1367549..1367615 + 67 NuclAT_28 - Antitoxin
- 1367549..1367615 + 67 NuclAT_28 - Antitoxin
- 1367549..1367615 + 67 NuclAT_30 - Antitoxin
- 1367549..1367615 + 67 NuclAT_30 - Antitoxin
- 1367549..1367615 + 67 NuclAT_30 - Antitoxin
- 1367549..1367615 + 67 NuclAT_30 - Antitoxin
- 1367549..1367615 + 67 NuclAT_32 - Antitoxin
- 1367549..1367615 + 67 NuclAT_32 - Antitoxin
- 1367549..1367615 + 67 NuclAT_32 - Antitoxin
- 1367549..1367615 + 67 NuclAT_32 - Antitoxin
- 1367549..1367615 + 67 NuclAT_34 - Antitoxin
- 1367549..1367615 + 67 NuclAT_34 - Antitoxin
- 1367549..1367615 + 67 NuclAT_34 - Antitoxin
- 1367549..1367615 + 67 NuclAT_34 - Antitoxin
- 1367549..1367615 + 67 NuclAT_36 - Antitoxin
- 1367549..1367615 + 67 NuclAT_36 - Antitoxin
- 1367549..1367615 + 67 NuclAT_36 - Antitoxin
- 1367549..1367615 + 67 NuclAT_36 - Antitoxin
- 1367549..1367615 + 67 NuclAT_38 - Antitoxin
- 1367549..1367615 + 67 NuclAT_38 - Antitoxin
- 1367549..1367615 + 67 NuclAT_38 - Antitoxin
- 1367549..1367615 + 67 NuclAT_38 - Antitoxin
- 1367551..1367614 + 64 NuclAT_41 - -
- 1367551..1367614 + 64 NuclAT_41 - -
- 1367551..1367614 + 64 NuclAT_41 - -
- 1367551..1367614 + 64 NuclAT_41 - -
CJU64_RS07090 1367929..1368036 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1368089..1368150 + 62 NuclAT_40 - -
- 1368089..1368150 + 62 NuclAT_40 - -
- 1368089..1368150 + 62 NuclAT_40 - -
- 1368089..1368150 + 62 NuclAT_40 - -
- 1368089..1368151 + 63 NuclAT_29 - -
- 1368089..1368151 + 63 NuclAT_29 - -
- 1368089..1368151 + 63 NuclAT_29 - -
- 1368089..1368151 + 63 NuclAT_29 - -
- 1368089..1368151 + 63 NuclAT_31 - -
- 1368089..1368151 + 63 NuclAT_31 - -
- 1368089..1368151 + 63 NuclAT_31 - -
- 1368089..1368151 + 63 NuclAT_31 - -
- 1368089..1368151 + 63 NuclAT_33 - -
- 1368089..1368151 + 63 NuclAT_33 - -
- 1368089..1368151 + 63 NuclAT_33 - -
- 1368089..1368151 + 63 NuclAT_33 - -
- 1368089..1368151 + 63 NuclAT_35 - -
- 1368089..1368151 + 63 NuclAT_35 - -
- 1368089..1368151 + 63 NuclAT_35 - -
- 1368089..1368151 + 63 NuclAT_35 - -
- 1368089..1368151 + 63 NuclAT_37 - -
- 1368089..1368151 + 63 NuclAT_37 - -
- 1368089..1368151 + 63 NuclAT_37 - -
- 1368089..1368151 + 63 NuclAT_37 - -
- 1368089..1368151 + 63 NuclAT_39 - -
- 1368089..1368151 + 63 NuclAT_39 - -
- 1368089..1368151 + 63 NuclAT_39 - -
- 1368089..1368151 + 63 NuclAT_39 - -
- 1368089..1368152 + 64 NuclAT_17 - -
- 1368089..1368152 + 64 NuclAT_17 - -
- 1368089..1368152 + 64 NuclAT_17 - -
- 1368089..1368152 + 64 NuclAT_17 - -
- 1368089..1368152 + 64 NuclAT_19 - -
- 1368089..1368152 + 64 NuclAT_19 - -
- 1368089..1368152 + 64 NuclAT_19 - -
- 1368089..1368152 + 64 NuclAT_19 - -
- 1368089..1368152 + 64 NuclAT_21 - -
- 1368089..1368152 + 64 NuclAT_21 - -
- 1368089..1368152 + 64 NuclAT_21 - -
- 1368089..1368152 + 64 NuclAT_21 - -
- 1368089..1368152 + 64 NuclAT_23 - -
- 1368089..1368152 + 64 NuclAT_23 - -
- 1368089..1368152 + 64 NuclAT_23 - -
- 1368089..1368152 + 64 NuclAT_23 - -
- 1368089..1368152 + 64 NuclAT_25 - -
- 1368089..1368152 + 64 NuclAT_25 - -
- 1368089..1368152 + 64 NuclAT_25 - -
- 1368089..1368152 + 64 NuclAT_25 - -
- 1368089..1368152 + 64 NuclAT_27 - -
- 1368089..1368152 + 64 NuclAT_27 - -
- 1368089..1368152 + 64 NuclAT_27 - -
- 1368089..1368152 + 64 NuclAT_27 - -
CJU64_RS07100 1368465..1368572 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1368620..1368687 + 68 NuclAT_16 - -
- 1368620..1368687 + 68 NuclAT_16 - -
- 1368620..1368687 + 68 NuclAT_16 - -
- 1368620..1368687 + 68 NuclAT_16 - -
- 1368620..1368687 + 68 NuclAT_18 - -
- 1368620..1368687 + 68 NuclAT_18 - -
- 1368620..1368687 + 68 NuclAT_18 - -
- 1368620..1368687 + 68 NuclAT_18 - -
- 1368620..1368687 + 68 NuclAT_20 - -
- 1368620..1368687 + 68 NuclAT_20 - -
- 1368620..1368687 + 68 NuclAT_20 - -
- 1368620..1368687 + 68 NuclAT_20 - -
- 1368620..1368687 + 68 NuclAT_22 - -
- 1368620..1368687 + 68 NuclAT_22 - -
- 1368620..1368687 + 68 NuclAT_22 - -
- 1368620..1368687 + 68 NuclAT_22 - -
- 1368620..1368687 + 68 NuclAT_24 - -
- 1368620..1368687 + 68 NuclAT_24 - -
- 1368620..1368687 + 68 NuclAT_24 - -
- 1368620..1368687 + 68 NuclAT_24 - -
- 1368620..1368687 + 68 NuclAT_26 - -
- 1368620..1368687 + 68 NuclAT_26 - -
- 1368620..1368687 + 68 NuclAT_26 - -
- 1368620..1368687 + 68 NuclAT_26 - -
CJU64_RS07110 1368977..1370077 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CJU64_RS07115 1370347..1370577 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CJU64_RS07120 1370735..1371430 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
CJU64_RS07125 1371474..1371827 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T80760 WP_000170954.1 NZ_CP023346:c1367501-1367394 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T80760 NZ_CP023346:c1367501-1367394 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT80760 NZ_CP023346:1367549-1367615 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References