Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2421264..2421448 | Replicon | chromosome |
Accession | NZ_CP023076 | ||
Organism | Staphylococcus argenteus strain XNO62 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | CJ017_RS11970 | Protein ID | WP_000482653.1 |
Coordinates | 2421341..2421448 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2421264..2421324 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJ017_RS11955 | 2417116..2418849 | - | 1734 | WP_031787186.1 | ABC transporter ATP-binding protein/permease | - |
CJ017_RS11960 | 2418874..2420637 | - | 1764 | WP_031787187.1 | ABC transporter ATP-binding protein/permease | - |
- | 2421264..2421324 | + | 61 | - | - | Antitoxin |
CJ017_RS11970 | 2421341..2421448 | - | 108 | WP_000482653.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CJ017_RS11975 | 2421582..2421968 | - | 387 | WP_000779346.1 | flippase GtxA | - |
CJ017_RS11980 | 2422236..2423378 | + | 1143 | WP_100848602.1 | glycerate kinase | - |
CJ017_RS11985 | 2423437..2424096 | + | 660 | WP_000831306.1 | membrane protein | - |
CJ017_RS11990 | 2424281..2425492 | + | 1212 | WP_031787189.1 | multidrug effflux MFS transporter | - |
CJ017_RS11995 | 2425608..2426087 | - | 480 | WP_031787190.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2399061..2458109 | 59048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4025.81 Da Isoelectric Point: 11.0582
>T80470 WP_000482653.1 NZ_CP023076:c2421448-2421341 [Staphylococcus argenteus]
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T80470 NZ_CP023076:c2421448-2421341 [Staphylococcus argenteus]
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT80470 NZ_CP023076:2421264-2421324 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|