Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 44162..44416 | Replicon | plasmid unnamed1 |
Accession | NZ_CP022913 | ||
Organism | Escherichia coli O6:H16 strain 2011EL-1370-2 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | CJZ79_RS25430 | Protein ID | WP_032186826.1 |
Coordinates | 44162..44368 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 44360..44416 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJZ79_RS25380 | 39412..40593 | - | 1182 | WP_001467544.1 | DUF3800 domain-containing protein | - |
CJZ79_RS25390 | 40851..41438 | + | 588 | Protein_43 | IS91 family transposase | - |
CJZ79_RS26945 | 41589..41768 | - | 180 | WP_032231585.1 | hypothetical protein | - |
CJZ79_RS25410 | 42471..43328 | - | 858 | WP_000130964.1 | incFII family plasmid replication initiator RepA | - |
CJZ79_RS25415 | 43321..43395 | - | 75 | WP_001365571.1 | RepA leader peptide Tap | - |
CJZ79_RS25425 | 43618..43878 | - | 261 | WP_000083817.1 | replication regulatory protein RepA | - |
CJZ79_RS25430 | 44162..44368 | - | 207 | WP_032186826.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 44360..44416 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 44360..44416 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 44360..44416 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 44360..44416 | + | 57 | NuclAT_1 | - | Antitoxin |
CJZ79_RS25440 | 44660..44842 | + | 183 | WP_001705320.1 | hypothetical protein | - |
CJZ79_RS25445 | 45067..45480 | - | 414 | WP_077625677.1 | type-F conjugative transfer system pilin acetylase TraX | - |
CJZ79_RS25450 | 46143..47594 | - | 1452 | Protein_51 | type IV conjugative transfer system coupling protein TraD | - |
CJZ79_RS25455 | 47594..47845 | - | 252 | Protein_52 | conjugal transfer protein TraK | - |
CJZ79_RS25460 | 47835..48398 | - | 564 | WP_000406020.1 | type IV conjugative transfer system protein TraE | - |
CJZ79_RS25465 | 48418..48723 | - | 306 | WP_000016323.1 | type IV conjugative transfer system protein TraL | - |
CJZ79_RS25470 | 48725..49084 | - | 360 | WP_001054220.1 | type IV conjugative transfer system pilin TraA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cofA | 1..63392 | 63392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7822.32 Da Isoelectric Point: 8.8807
>T80148 WP_032186826.1 NZ_CP022913:c44368-44162 [Escherichia coli O6:H16]
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T80148 NZ_CP022913:c44368-44162 [Escherichia coli O6:H16]
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATACCCTTATTGG
GTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATACCCTTATTGG
GTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT80148 NZ_CP022913:44360-44416 [Escherichia coli O6:H16]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|