Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2199760..2199977 | Replicon | chromosome |
| Accession | NZ_CP022910 | ||
| Organism | Staphylococcus aureus strain 164 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | CGP88_RS11580 | Protein ID | WP_001802298.1 |
| Coordinates | 2199873..2199977 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2199760..2199815 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGP88_RS11560 | 2195897..2196562 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| CGP88_RS11565 | 2196714..2197034 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| CGP88_RS11570 | 2197036..2198016 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| CGP88_RS11575 | 2198282..2199373 | + | 1092 | WP_115285413.1 | transcriptional regulator | - |
| - | 2199760..2199815 | + | 56 | - | - | Antitoxin |
| CGP88_RS11580 | 2199873..2199977 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| CGP88_RS14920 | 2200138..2200621 | - | 484 | Protein_2135 | recombinase family protein | - |
| CGP88_RS11590 | 2200664..2201800 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| CGP88_RS11595 | 2202089..2202181 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| CGP88_RS11600 | 2202886..2203743 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| CGP88_RS11605 | 2203811..2204593 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T80123 WP_001802298.1 NZ_CP022910:c2199977-2199873 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T80123 NZ_CP022910:c2199977-2199873 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT80123 NZ_CP022910:2199760-2199815 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|