Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2024255..2024554 | Replicon | chromosome |
Accession | NZ_CP022910 | ||
Organism | Staphylococcus aureus strain 164 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | CGP88_RS10525 | Protein ID | WP_072353918.1 |
Coordinates | 2024378..2024554 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2024255..2024310 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP88_RS10470 | 2019812..2019991 | + | 180 | WP_000669789.1 | hypothetical protein | - |
CGP88_RS10480 | 2020302..2020562 | + | 261 | WP_001791826.1 | hypothetical protein | - |
CGP88_RS10485 | 2020615..2020965 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
CGP88_RS10490 | 2021476..2021810 | - | 335 | Protein_1931 | SH3 domain-containing protein | - |
CGP88_RS10505 | 2022463..2022954 | - | 492 | WP_000920041.1 | staphylokinase | - |
CGP88_RS10510 | 2023145..2023900 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CGP88_RS10515 | 2023912..2024166 | - | 255 | WP_000611512.1 | phage holin | - |
CGP88_RS10520 | 2024218..2024325 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2024247..2024386 | + | 140 | NuclAT_0 | - | - |
- | 2024247..2024386 | + | 140 | NuclAT_0 | - | - |
- | 2024247..2024386 | + | 140 | NuclAT_0 | - | - |
- | 2024247..2024386 | + | 140 | NuclAT_0 | - | - |
- | 2024255..2024310 | + | 56 | - | - | Antitoxin |
CGP88_RS10525 | 2024378..2024554 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
CGP88_RS10530 | 2024697..2025071 | - | 375 | WP_000340977.1 | hypothetical protein | - |
CGP88_RS10535 | 2025127..2025414 | - | 288 | WP_001262620.1 | hypothetical protein | - |
CGP88_RS10540 | 2025460..2025612 | - | 153 | WP_001000058.1 | hypothetical protein | - |
CGP88_RS10545 | 2025605..2029387 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2020615..2076561 | 55946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T80115 WP_072353918.1 NZ_CP022910:c2024554-2024378 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T80115 NZ_CP022910:c2024554-2024378 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT80115 NZ_CP022910:2024255-2024310 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|