Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1864092..1864274 | Replicon | chromosome |
Accession | NZ_CP022910 | ||
Organism | Staphylococcus aureus strain 164 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP88_RS09465 | Protein ID | WP_001801861.1 |
Coordinates | 1864092..1864187 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1864215..1864274 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP88_RS09415 | 1859752..1860378 | + | 627 | WP_000669046.1 | hypothetical protein | - |
CGP88_RS09420 | 1860419..1860763 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
CGP88_RS09425 | 1860861..1861412 | + | 552 | WP_000414205.1 | hypothetical protein | - |
CGP88_RS09430 | 1861630..1862271 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CGP88_RS09435 | 1862385..1862570 | - | 186 | WP_000809857.1 | hypothetical protein | - |
CGP88_RS09440 | 1862572..1862748 | - | 177 | WP_000375476.1 | hypothetical protein | - |
CGP88_RS09445 | 1862759..1863142 | - | 384 | WP_000070811.1 | hypothetical protein | - |
CGP88_RS09455 | 1863746..1863889 | - | 144 | WP_001549059.1 | transposase | - |
CGP88_RS09465 | 1864092..1864187 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1864215..1864274 | - | 60 | - | - | Antitoxin |
CGP88_RS09470 | 1864310..1864411 | + | 102 | WP_001791893.1 | hypothetical protein | - |
CGP88_RS09475 | 1864389..1864565 | - | 177 | Protein_1780 | transposase | - |
CGP88_RS09480 | 1864759..1865136 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1838066..1897365 | 59299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T80112 WP_001801861.1 NZ_CP022910:1864092-1864187 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T80112 NZ_CP022910:1864092-1864187 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT80112 NZ_CP022910:c1864274-1864215 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|