Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1957048..1957230 | Replicon | chromosome |
| Accession | NZ_CP022908 | ||
| Organism | Staphylococcus aureus strain 545 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CGQ00_RS10135 | Protein ID | WP_001801861.1 |
| Coordinates | 1957048..1957143 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1957171..1957230 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ00_RS10085 | 1952708..1953334 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| CGQ00_RS10090 | 1953375..1953719 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| CGQ00_RS10095 | 1953817..1954368 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| CGQ00_RS10100 | 1954586..1955227 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CGQ00_RS10105 | 1955341..1955526 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| CGQ00_RS10110 | 1955528..1955704 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| CGQ00_RS10115 | 1955715..1956098 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| CGQ00_RS10125 | 1956702..1956845 | - | 144 | WP_001549059.1 | transposase | - |
| CGQ00_RS10135 | 1957048..1957143 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1957171..1957230 | - | 60 | - | - | Antitoxin |
| CGQ00_RS10140 | 1957266..1957367 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| CGQ00_RS10145 | 1957345..1957521 | - | 177 | Protein_1907 | transposase | - |
| CGQ00_RS10150 | 1957715..1958092 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| CGQ00_RS10155 | 1958613..1959440 | - | 828 | Protein_1909 | ATP-binding protein | - |
| CGQ00_RS10160 | 1959490..1960662 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1931133..1977091 | 45958 | |
| - | flank | IS/Tn | - | - | 1959490..1960662 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T80097 WP_001801861.1 NZ_CP022908:1957048-1957143 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T80097 NZ_CP022908:1957048-1957143 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT80097 NZ_CP022908:c1957230-1957171 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|