Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2549573..2549757 | Replicon | chromosome |
| Accession | NZ_CP022906 | ||
| Organism | Staphylococcus aureus strain 546 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | CGP99_RS13530 | Protein ID | WP_000482650.1 |
| Coordinates | 2549650..2549757 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2549573..2549633 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGP99_RS13505 | 2545103..2545270 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| CGP99_RS13505 | 2545103..2545270 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| CGP99_RS13515 | 2545501..2547234 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| CGP99_RS13515 | 2545501..2547234 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| CGP99_RS13520 | 2547259..2549022 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| CGP99_RS13520 | 2547259..2549022 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2549573..2549633 | + | 61 | - | - | Antitoxin |
| CGP99_RS13530 | 2549650..2549757 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CGP99_RS13530 | 2549650..2549757 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CGP99_RS13535 | 2549891..2550277 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| CGP99_RS13535 | 2549891..2550277 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| CGP99_RS13540 | 2550545..2551687 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| CGP99_RS13540 | 2550545..2551687 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| CGP99_RS13545 | 2551747..2552406 | + | 660 | WP_000831298.1 | membrane protein | - |
| CGP99_RS13545 | 2551747..2552406 | + | 660 | WP_000831298.1 | membrane protein | - |
| CGP99_RS13550 | 2552588..2553799 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| CGP99_RS13550 | 2552588..2553799 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| CGP99_RS13555 | 2553922..2554395 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| CGP99_RS13555 | 2553922..2554395 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T80087 WP_000482650.1 NZ_CP022906:c2549757-2549650 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T80087 NZ_CP022906:c2549757-2549650 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT80087 NZ_CP022906:2549573-2549633 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|