Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 274687..274871 | Replicon | chromosome |
Accession | NZ_CP022904 | ||
Organism | Staphylococcus aureus strain 629 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | CGQ02_RS01310 | Protein ID | WP_000482652.1 |
Coordinates | 274687..274794 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 274811..274871 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGQ02_RS01285 | 270049..270522 | + | 474 | WP_015445934.1 | GyrI-like domain-containing protein | - |
CGQ02_RS01290 | 270645..271856 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
CGQ02_RS01295 | 272038..272697 | - | 660 | WP_000831302.1 | hypothetical protein | - |
CGQ02_RS01300 | 272757..273899 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
CGQ02_RS01305 | 274167..274553 | + | 387 | WP_000779360.1 | flippase GtxA | - |
CGQ02_RS01310 | 274687..274794 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 274811..274871 | - | 61 | - | - | Antitoxin |
CGQ02_RS01320 | 275497..277260 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
CGQ02_RS01325 | 277285..279018 | + | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
CGQ02_RS01335 | 279249..279416 | + | 168 | Protein_242 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T80040 WP_000482652.1 NZ_CP022904:274687-274794 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T80040 NZ_CP022904:274687-274794 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT80040 NZ_CP022904:c274871-274811 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|