Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1824847..1825146 | Replicon | chromosome |
Accession | NZ_CP022903 | ||
Organism | Staphylococcus aureus strain 187 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CGQ01_RS09575 | Protein ID | WP_011447039.1 |
Coordinates | 1824970..1825146 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1824847..1824902 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGQ01_RS09530 | 1820179..1820439 | + | 261 | WP_001791826.1 | hypothetical protein | - |
CGQ01_RS09535 | 1820492..1820842 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
CGQ01_RS09540 | 1821526..1821975 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
CGQ01_RS09545 | 1822070..1822405 | - | 336 | Protein_1751 | SH3 domain-containing protein | - |
CGQ01_RS09555 | 1823055..1823546 | - | 492 | WP_000919350.1 | staphylokinase | - |
CGQ01_RS09560 | 1823737..1824492 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CGQ01_RS09565 | 1824504..1824758 | - | 255 | WP_000611512.1 | phage holin | - |
CGQ01_RS09570 | 1824810..1824917 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1824839..1824978 | + | 140 | NuclAT_0 | - | - |
- | 1824839..1824978 | + | 140 | NuclAT_0 | - | - |
- | 1824839..1824978 | + | 140 | NuclAT_0 | - | - |
- | 1824839..1824978 | + | 140 | NuclAT_0 | - | - |
- | 1824847..1824902 | + | 56 | - | - | Antitoxin |
CGQ01_RS09575 | 1824970..1825146 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CGQ01_RS09580 | 1825296..1825592 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CGQ01_RS09585 | 1825650..1825937 | - | 288 | WP_001040261.1 | hypothetical protein | - |
CGQ01_RS09590 | 1825984..1826136 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CGQ01_RS09595 | 1826126..1829911 | - | 3786 | WP_000582178.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / chp / sak / hlb / groEL / hld | 1816996..1891734 | 74738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T80035 WP_011447039.1 NZ_CP022903:c1825146-1824970 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T80035 NZ_CP022903:c1825146-1824970 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT80035 NZ_CP022903:1824847-1824902 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|