Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 273355..273539 | Replicon | chromosome |
Accession | NZ_CP022903 | ||
Organism | Staphylococcus aureus strain 187 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | CGQ01_RS01300 | Protein ID | WP_000482652.1 |
Coordinates | 273355..273462 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 273479..273539 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGQ01_RS01275 | 268717..269190 | + | 474 | WP_015445934.1 | GyrI-like domain-containing protein | - |
CGQ01_RS01280 | 269313..270524 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
CGQ01_RS01285 | 270706..271365 | - | 660 | WP_000831302.1 | hypothetical protein | - |
CGQ01_RS01290 | 271425..272567 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
CGQ01_RS01295 | 272835..273221 | + | 387 | WP_000779360.1 | flippase GtxA | - |
CGQ01_RS01300 | 273355..273462 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 273479..273539 | - | 61 | - | - | Antitoxin |
CGQ01_RS01310 | 274165..275928 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
CGQ01_RS01315 | 275953..277686 | + | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
CGQ01_RS01325 | 277917..278084 | + | 168 | Protein_240 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T80022 WP_000482652.1 NZ_CP022903:273355-273462 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T80022 NZ_CP022903:273355-273462 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT80022 NZ_CP022903:c273539-273479 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|