Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1876964..1877144 | Replicon | chromosome |
Accession | NZ_CP022900 | ||
Organism | Staphylococcus aureus strain 468 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP96_RS09240 | Protein ID | WP_001801861.1 |
Coordinates | 1876964..1877059 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1877087..1877144 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP96_RS09205 | 1872108..1872734 | + | 627 | WP_000669038.1 | hypothetical protein | - |
CGP96_RS09210 | 1872775..1873119 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
CGP96_RS09215 | 1873217..1873789 | + | 573 | WP_000414222.1 | hypothetical protein | - |
CGP96_RS09220 | 1873938..1875305 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
CGP96_RS09225 | 1875305..1875874 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
CGP96_RS09230 | 1876067..1876513 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
CGP96_RS09240 | 1876964..1877059 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1877087..1877144 | - | 58 | - | - | Antitoxin |
CGP96_RS09245 | 1877182..1877283 | + | 102 | WP_001791232.1 | hypothetical protein | - |
CGP96_RS09250 | 1877458..1877901 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
CGP96_RS09255 | 1877901..1878344 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
CGP96_RS09260 | 1878344..1878786 | - | 443 | Protein_1749 | DUF1433 domain-containing protein | - |
CGP96_RS09265 | 1879311..1881731 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79974 WP_001801861.1 NZ_CP022900:1876964-1877059 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79974 NZ_CP022900:1876964-1877059 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79974 NZ_CP022900:c1877144-1877087 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|