Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2508831..2509015 | Replicon | chromosome |
Accession | NZ_CP022899 | ||
Organism | Staphylococcus aureus strain 143 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | CGP95_RS12925 | Protein ID | WP_000482647.1 |
Coordinates | 2508908..2509015 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2508831..2508891 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP95_RS12900 | 2504341..2504508 | - | 168 | Protein_2395 | hypothetical protein | - |
CGP95_RS12910 | 2504739..2506472 | - | 1734 | WP_115283889.1 | ABC transporter ATP-binding protein/permease | - |
CGP95_RS12915 | 2506497..2508260 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2508831..2508891 | + | 61 | - | - | Antitoxin |
CGP95_RS12925 | 2508908..2509015 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CGP95_RS12930 | 2509149..2509535 | - | 387 | WP_000779351.1 | flippase GtxA | - |
CGP95_RS12935 | 2509803..2510945 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
CGP95_RS12940 | 2511005..2511664 | + | 660 | WP_115283890.1 | hypothetical protein | - |
CGP95_RS12945 | 2511846..2513057 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
CGP95_RS12950 | 2513180..2513653 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T79970 WP_000482647.1 NZ_CP022899:c2509015-2508908 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T79970 NZ_CP022899:c2509015-2508908 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT79970 NZ_CP022899:2508831-2508891 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|