Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1965939..1966238 | Replicon | chromosome |
Accession | NZ_CP022899 | ||
Organism | Staphylococcus aureus strain 143 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CGP95_RS09880 | Protein ID | WP_011447039.1 |
Coordinates | 1966062..1966238 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1965939..1965994 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP95_RS09835 | 1961497..1962012 | - | 516 | WP_000163281.1 | type 1 glutamine amidotransferase | - |
CGP95_RS09840 | 1962142..1962303 | - | 162 | WP_001005407.1 | hypothetical protein | - |
CGP95_RS09845 | 1962650..1962730 | + | 81 | WP_100250272.1 | hypothetical protein | - |
CGP95_RS09850 | 1962800..1963537 | - | 738 | WP_000278830.1 | hypothetical protein | - |
CGP95_RS09855 | 1963544..1964338 | - | 795 | WP_000238963.1 | phosphatidylinositol kinase | - |
CGP95_RS09865 | 1964829..1965584 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CGP95_RS09870 | 1965596..1965850 | - | 255 | WP_000611512.1 | phage holin | - |
CGP95_RS09875 | 1965902..1966009 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1965931..1966070 | + | 140 | NuclAT_0 | - | - |
- | 1965931..1966070 | + | 140 | NuclAT_0 | - | - |
- | 1965931..1966070 | + | 140 | NuclAT_0 | - | - |
- | 1965931..1966070 | + | 140 | NuclAT_0 | - | - |
- | 1965939..1965994 | + | 56 | - | - | Antitoxin |
CGP95_RS09880 | 1966062..1966238 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CGP95_RS09885 | 1966388..1966684 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CGP95_RS09890 | 1966742..1967029 | - | 288 | WP_001040261.1 | hypothetical protein | - |
CGP95_RS09895 | 1967076..1967228 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CGP95_RS09900 | 1967218..1971003 | - | 3786 | WP_115283867.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1961497..2000867 | 39370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T79962 WP_011447039.1 NZ_CP022899:c1966238-1966062 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T79962 NZ_CP022899:c1966238-1966062 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT79962 NZ_CP022899:1965939-1965994 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|