Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2214320..2214537 | Replicon | chromosome |
Accession | NZ_CP022898 | ||
Organism | Staphylococcus aureus strain 422 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | CGP94_RS11500 | Protein ID | WP_001802298.1 |
Coordinates | 2214433..2214537 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2214320..2214375 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP94_RS11480 | 2210451..2211116 | - | 666 | WP_001024091.1 | SDR family oxidoreductase | - |
CGP94_RS11485 | 2211268..2211588 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CGP94_RS11490 | 2211590..2212570 | + | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
CGP94_RS11495 | 2212836..2213927 | + | 1092 | WP_047213685.1 | hypothetical protein | - |
- | 2214320..2214375 | + | 56 | - | - | Antitoxin |
CGP94_RS11500 | 2214433..2214537 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
CGP94_RS14630 | 2214698..2215195 | - | 498 | Protein_2116 | recombinase family protein | - |
CGP94_RS11510 | 2215245..2216372 | - | 1128 | WP_047213687.1 | SAP domain-containing protein | - |
CGP94_RS11515 | 2217421..2218278 | - | 858 | WP_000370936.1 | Cof-type HAD-IIB family hydrolase | - |
CGP94_RS11520 | 2218346..2219128 | - | 783 | WP_000908193.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T79951 WP_001802298.1 NZ_CP022898:c2214537-2214433 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T79951 NZ_CP022898:c2214537-2214433 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT79951 NZ_CP022898:2214320-2214375 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|