Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2206799..2207015 | Replicon | chromosome |
Accession | NZ_CP022895 | ||
Organism | Staphylococcus aureus strain 85 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | CGP91_RS11295 | Protein ID | WP_073392962.1 |
Coordinates | 2206911..2207015 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2206799..2206854 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP91_RS11275 | 2201892..2202212 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CGP91_RS11280 | 2202214..2203194 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
CGP91_RS11285 | 2203460..2204551 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
CGP91_RS11290 | 2204839..2206485 | + | 1647 | WP_000277709.1 | IS1182-like element ISSau3 family transposase | - |
- | 2206799..2206854 | + | 56 | - | - | Antitoxin |
CGP91_RS11295 | 2206911..2207015 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
CGP91_RS11305 | 2207695..2207853 | + | 159 | WP_001792784.1 | hypothetical protein | - |
CGP91_RS11315 | 2208512..2209369 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
CGP91_RS11320 | 2209437..2210219 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2204839..2206485 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T79909 WP_073392962.1 NZ_CP022895:c2207015-2206911 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T79909 NZ_CP022895:c2207015-2206911 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT79909 NZ_CP022895:2206799-2206854 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|