Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1873493..1873673 | Replicon | chromosome |
Accession | NZ_CP022895 | ||
Organism | Staphylococcus aureus strain 85 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP91_RS09250 | Protein ID | WP_001801861.1 |
Coordinates | 1873493..1873588 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1873616..1873673 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP91_RS09215 | 1868637..1869263 | + | 627 | WP_000669038.1 | hypothetical protein | - |
CGP91_RS09220 | 1869304..1869648 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
CGP91_RS09225 | 1869746..1870318 | + | 573 | WP_000414222.1 | hypothetical protein | - |
CGP91_RS09230 | 1870467..1871834 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
CGP91_RS09235 | 1871834..1872403 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
CGP91_RS09240 | 1872596..1873042 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
CGP91_RS09250 | 1873493..1873588 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1873616..1873673 | - | 58 | - | - | Antitoxin |
CGP91_RS09255 | 1873711..1873812 | + | 102 | WP_001791232.1 | hypothetical protein | - |
CGP91_RS09260 | 1873987..1874430 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
CGP91_RS09265 | 1874430..1874873 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
CGP91_RS09270 | 1874873..1875315 | - | 443 | Protein_1751 | DUF1433 domain-containing protein | - |
CGP91_RS09275 | 1875840..1878260 | + | 2421 | WP_115300166.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hysA / selk | 1866078..1903435 | 37357 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79900 WP_001801861.1 NZ_CP022895:1873493-1873588 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79900 NZ_CP022895:1873493-1873588 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79900 NZ_CP022895:c1873673-1873616 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|