Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 27193..27457 | Replicon | plasmid pSA186_5 |
Accession | NZ_CP022734 | ||
Organism | Escherichia coli strain SA186 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | CHQ92_RS26070 | Protein ID | WP_001303307.1 |
Coordinates | 27193..27345 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 27395..27457 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CHQ92_RS26040 | 22396..24564 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
CHQ92_RS26045 | 24640..25254 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CHQ92_RS26050 | 25352..25561 | + | 210 | Protein_25 | hemolysin expression modulator Hha | - |
CHQ92_RS28135 | 25770..25946 | + | 177 | WP_001054900.1 | hypothetical protein | - |
- | 26432..26483 | + | 52 | NuclAT_2 | - | - |
- | 26432..26483 | + | 52 | NuclAT_2 | - | - |
- | 26432..26483 | + | 52 | NuclAT_2 | - | - |
- | 26432..26483 | + | 52 | NuclAT_2 | - | - |
CHQ92_RS26065 | 26870..27121 | + | 252 | WP_001291965.1 | hypothetical protein | - |
CHQ92_RS26070 | 27193..27345 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
- | 27395..27457 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 27395..27457 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 27395..27457 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 27395..27457 | + | 63 | NuclAT_0 | - | Antitoxin |
CHQ92_RS26075 | 27660..28751 | + | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 28818..28878 | + | 61 | NuclAT_1 | - | - |
- | 28818..28878 | + | 61 | NuclAT_1 | - | - |
- | 28818..28878 | + | 61 | NuclAT_1 | - | - |
- | 28818..28878 | + | 61 | NuclAT_1 | - | - |
CHQ92_RS26080 | 29058..30266 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
CHQ92_RS26085 | 30285..31355 | + | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..106936 | 106936 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T79692 WP_001303307.1 NZ_CP022734:c27345-27193 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T79692 NZ_CP022734:c27345-27193 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT79692 NZ_CP022734:27395-27457 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|