Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 91031..91300 | Replicon | plasmid pSA186_3 |
Accession | NZ_CP022732 | ||
Organism | Escherichia coli strain SA186 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CHQ92_RS25155 | Protein ID | WP_001312861.1 |
Coordinates | 91142..91300 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 91031..91096 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CHQ92_RS25130 | 86840..87337 | + | 498 | WP_089552049.1 | single-stranded DNA-binding protein | - |
CHQ92_RS25135 | 87400..87633 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
CHQ92_RS25140 | 87699..89657 | + | 1959 | WP_023148339.1 | ParB/RepB/Spo0J family partition protein | - |
CHQ92_RS25145 | 89712..90146 | + | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
CHQ92_RS25150 | 90143..90862 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
CHQ92_RS28115 | 90874..91062 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 90874..91098 | + | 225 | NuclAT_0 | - | - |
- | 90874..91098 | + | 225 | NuclAT_0 | - | - |
- | 90874..91098 | + | 225 | NuclAT_0 | - | - |
- | 90874..91098 | + | 225 | NuclAT_0 | - | - |
- | 91031..91096 | + | 66 | - | - | Antitoxin |
CHQ92_RS25155 | 91142..91300 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CHQ92_RS28260 | 91991..92197 | + | 207 | WP_000547939.1 | hypothetical protein | - |
CHQ92_RS25175 | 92222..92509 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CHQ92_RS25180 | 92631..93452 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CHQ92_RS25185 | 93749..94351 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
CHQ92_RS25190 | 94672..95055 | + | 384 | WP_053320747.1 | relaxosome protein TraM | - |
CHQ92_RS25195 | 95242..95931 | + | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId | iroN / iroE / iroD / iroC / iroB | 1..113162 | 113162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T79688 WP_001312861.1 NZ_CP022732:91142-91300 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T79688 NZ_CP022732:91142-91300 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT79688 NZ_CP022732:91031-91096 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|