Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2419184..2419368 | Replicon | chromosome |
Accession | NZ_CP022720 | ||
Organism | Staphylococcus aureus strain 135 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | CGP86_RS12510 | Protein ID | WP_000482647.1 |
Coordinates | 2419261..2419368 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2419184..2419244 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP86_RS12485 | 2414638..2414805 | - | 168 | WP_001792506.1 | hypothetical protein | - |
CGP86_RS12495 | 2415036..2416769 | - | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
CGP86_RS12500 | 2416794..2418557 | - | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
- | 2419184..2419244 | + | 61 | - | - | Antitoxin |
CGP86_RS12510 | 2419261..2419368 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CGP86_RS12515 | 2419502..2419888 | - | 387 | WP_000779360.1 | flippase GtxA | - |
CGP86_RS12520 | 2420146..2421288 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
CGP86_RS12525 | 2421348..2422007 | + | 660 | WP_000831295.1 | hypothetical protein | - |
CGP86_RS12530 | 2422189..2423400 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
CGP86_RS12535 | 2423523..2423996 | - | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T79648 WP_000482647.1 NZ_CP022720:c2419368-2419261 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T79648 NZ_CP022720:c2419368-2419261 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT79648 NZ_CP022720:2419184-2419244 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|