Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1805092..1805272 | Replicon | chromosome |
| Accession | NZ_CP022607 | ||
| Organism | Staphylococcus aureus strain FORC_061 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FORC61_RS08965 | Protein ID | WP_001801861.1 |
| Coordinates | 1805092..1805187 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1805215..1805272 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC61_RS08920 | 1800133..1800759 | + | 627 | WP_000669021.1 | hypothetical protein | - |
| FORC61_RS08925 | 1800800..1801141 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
| FORC61_RS08930 | 1801242..1801814 | + | 573 | WP_000414206.1 | hypothetical protein | - |
| FORC61_RS08935 | 1802012..1802569 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FORC61_RS08945 | 1802940..1803116 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| FORC61_RS08950 | 1803127..1803510 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FORC61_RS08955 | 1804195..1804641 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| FORC61_RS08965 | 1805092..1805187 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1805215..1805272 | - | 58 | - | - | Antitoxin |
| FORC61_RS08970 | 1805310..1805411 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| FORC61_RS08975 | 1805389..1805571 | - | 183 | Protein_1681 | transposase | - |
| FORC61_RS08980 | 1805759..1806133 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| FORC61_RS08985 | 1806155..1806502 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
| FORC61_RS08990 | 1806712..1807155 | - | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
| FORC61_RS08995 | 1807803..1808921 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1779277..1834167 | 54890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79405 WP_001801861.1 NZ_CP022607:1805092-1805187 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79405 NZ_CP022607:1805092-1805187 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79405 NZ_CP022607:c1805272-1805215 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|