Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2004243..2004423 | Replicon | chromosome |
| Accession | NZ_CP022582 | ||
| Organism | Staphylococcus aureus strain FORC_062 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FORC62_RS10325 | Protein ID | WP_001801861.1 |
| Coordinates | 2004243..2004338 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2004366..2004423 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC62_RS10295 | 1999406..2000056 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| FORC62_RS10300 | 2000137..2001132 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| FORC62_RS10305 | 2001207..2001833 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| FORC62_RS10310 | 2001874..2002215 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| FORC62_RS10315 | 2002316..2002888 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| FORC62_RS10320 | 2003086..2004098 | - | 1013 | Protein_1941 | IS3 family transposase | - |
| FORC62_RS10325 | 2004243..2004338 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2004366..2004423 | - | 58 | - | - | Antitoxin |
| FORC62_RS10330 | 2004461..2004562 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| FORC62_RS10335 | 2004540..2004701 | - | 162 | Protein_1944 | transposase | - |
| FORC62_RS10340 | 2004692..2005186 | - | 495 | Protein_1945 | transposase | - |
| FORC62_RS10345 | 2005638..2006867 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
| FORC62_RS10350 | 2006860..2008416 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| FORC62_RS10355 | 2008580..2008714 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1980225..2031255 | 51030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79377 WP_001801861.1 NZ_CP022582:2004243-2004338 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79377 NZ_CP022582:2004243-2004338 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79377 NZ_CP022582:c2004423-2004366 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|