Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 309107..309301 | Replicon | chromosome |
Accession | NZ_CP022488 | ||
Organism | Enterococcus faecalis ARO1/DG |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | CG806_RS14715 | Protein ID | WP_015543884.1 |
Coordinates | 309206..309301 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 309107..309171 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CG806_RS02595 | 304732..306480 | + | 1749 | WP_010818670.1 | PTS transporter subunit EIIC | - |
CG806_RS02600 | 306471..308504 | + | 2034 | WP_002366094.1 | transcription antiterminator | - |
CG806_RS02605 | 308515..308949 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 309107..309171 | + | 65 | NuclAT_12 | - | Antitoxin |
CG806_RS14715 | 309206..309301 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CG806_RS02615 | 309547..311319 | + | 1773 | WP_002380023.1 | PTS mannitol transporter subunit IICBA | - |
CG806_RS02620 | 311334..311771 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
CG806_RS02625 | 311786..312940 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
CG806_RS02630 | 313008..314123 | - | 1116 | WP_002366097.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T79129 WP_015543884.1 NZ_CP022488:c309301-309206 [Enterococcus faecalis ARO1/DG]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T79129 NZ_CP022488:c309301-309206 [Enterococcus faecalis ARO1/DG]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT79129 NZ_CP022488:309107-309171 [Enterococcus faecalis ARO1/DG]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|