Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 11451..11692 | Replicon | plasmid pARO1.3 |
Accession | NZ_CP022486 | ||
Organism | Enterococcus faecalis ARO1/DG |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | CG806_RS00830 | Protein ID | WP_002360667.1 |
Coordinates | 11451..11561 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 11601..11692 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CG806_RS00780 | 7392..7631 | + | 240 | WP_000635249.1 | peptide-binding protein | - |
CG806_RS00785 | 7680..7763 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
CG806_RS00790 | 7888..8625 | + | 738 | WP_024418925.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
CG806_RS00800 | 8795..9055 | + | 261 | Protein_10 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
CG806_RS00805 | 9158..10054 | + | 897 | WP_002326827.1 | ParA family protein | - |
CG806_RS00810 | 10152..10361 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
CG806_RS00815 | 10379..10651 | + | 273 | WP_002326825.1 | antitoxin | - |
CG806_RS00820 | 10653..10730 | + | 78 | Protein_14 | zeta toxin | - |
CG806_RS00825 | 10784..11395 | - | 612 | Protein_15 | IS6-like element ISEnfa1 family transposase | - |
CG806_RS00830 | 11451..11561 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 11601..11692 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 11601..11692 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 11601..11692 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 11601..11692 | - | 92 | NuclAT_0 | - | Antitoxin |
CG806_RS00835 | 11801..12097 | + | 297 | WP_002403282.1 | hypothetical protein | - |
CG806_RS00840 | 12256..12597 | - | 342 | WP_002382053.1 | hypothetical protein | - |
CG806_RS00845 | 12601..13548 | - | 948 | WP_002386477.1 | AAA family ATPase | - |
CG806_RS00850 | 13899..14906 | + | 1008 | WP_002382056.1 | replication initiator protein A | - |
CG806_RS00855 | 14935..16115 | + | 1181 | Protein_21 | TraB family protein | - |
CG806_RS00860 | 16180..16446 | + | 267 | Protein_22 | peptide ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / VanHAX | - | 1..31392 | 31392 | |
- | flank | IS/Tn | erm(B) | - | 7888..11404 | 3516 | |
- | flank | IS/Tn | VanHAX | - | 16506..22038 | 5532 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T79127 WP_002360667.1 NZ_CP022486:11451-11561 [Enterococcus faecalis ARO1/DG]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T79127 NZ_CP022486:11451-11561 [Enterococcus faecalis ARO1/DG]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 92 bp
>AT79127 NZ_CP022486:c11692-11601 [Enterococcus faecalis ARO1/DG]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|