Detailed information of TA system TA079124

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 11451..11665
• Replicon: plasmid pARO1.3
• Accession: NZ_CP022486
• Organism: Enterococcus faecalis ARO1/DG

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: CG806_RS00830
• Protein ID: WP_002360667.1
• Coordinates: 11451..11561 (+)
• Length: 37 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	11601..11665 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CG806_RS00780	7392..7631	+	240	WP_000635249.1	peptide-binding protein	-
CG806_RS00785	7680..7763	+	84	WP_001814874.1	23S rRNA methyltransferase attenuation leader peptide	-
CG806_RS00790	7888..8625	+	738	WP_024418925.1	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	-
CG806_RS00800	8795..9055	+	261	Protein_10	topoisomerase DNA-binding C4 zinc finger domain-containing protein	-
CG806_RS00805	9158..10054	+	897	WP_002326827.1	ParA family protein	-
CG806_RS00810	10152..10361	+	210	WP_000527318.1	peptide-binding protein	-
CG806_RS00815	10379..10651	+	273	WP_002326825.1	antitoxin	-
CG806_RS00820	10653..10730	+	78	Protein_14	zeta toxin	-
CG806_RS00825	10784..11395	-	612	Protein_15	IS6-like element ISEnfa1 family transposase	-
CG806_RS00830	11451..11561	+	111	WP_002360667.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	11601..11665	-	65	-	-	Antitoxin
CG806_RS00835	11801..12097	+	297	WP_002403282.1	hypothetical protein	-
CG806_RS00840	12256..12597	-	342	WP_002382053.1	hypothetical protein	-
CG806_RS00845	12601..13548	-	948	WP_002386477.1	AAA family ATPase	-
CG806_RS00850	13899..14906	+	1008	WP_002382056.1	replication initiator protein A	-
CG806_RS00855	14935..16115	+	1181	Protein_21	TraB family protein	-
CG806_RS00860	16180..16446	+	267	Protein_22	peptide ABC transporter substrate-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	erm(B) / VanHAX	-	1..31392	31392
	-	flank	IS/Tn	erm(B)	-	7888..11404	3516
	-	flank	IS/Tn	VanHAX	-	16506..22038	5532

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 37 a.a.
• Molecular weight: 4117.92 Da
• Isoelectric Point: 4.1672

>T79124 WP_002360667.1 NZ_CP022486:11451-11561 [Enterococcus faecalis ARO1/DG]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Nucleotide

• Length: 111 bp

>T79124 NZ_CP022486:11451-11561 [Enterococcus faecalis ARO1/DG]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA

Antitoxin

Nucleotide

• Length: 65 bp

>AT79124 NZ_CP022486:c11665-11601 [Enterococcus faecalis ARO1/DG]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin