Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2152246..2152444 | Replicon | chromosome |
Accession | NZ_CP022291 | ||
Organism | Staphylococcus aureus strain EDCC5464 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | CFN13_RS10990 | Protein ID | WP_075583739.1 |
Coordinates | 2152340..2152444 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2152246..2152284 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFN13_RS10970 | 2148349..2149014 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
CFN13_RS10975 | 2149166..2149486 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CFN13_RS10980 | 2149488..2150468 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
CFN13_RS10985 | 2150734..2151825 | + | 1092 | WP_000495680.1 | hypothetical protein | - |
- | 2152246..2152284 | + | 39 | - | - | Antitoxin |
CFN13_RS10990 | 2152340..2152444 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
CFN13_RS10995 | 2152542..2152703 | - | 162 | Protein_2038 | helix-turn-helix domain-containing protein | - |
CFN13_RS11005 | 2153121..2153279 | + | 159 | WP_024928151.1 | hypothetical protein | - |
CFN13_RS11015 | 2153939..2154796 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
CFN13_RS11020 | 2154864..2155646 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T78850 WP_075583739.1 NZ_CP022291:c2152444-2152340 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
>T78850 NZ_CP022291:c2152444-2152340 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT78850 NZ_CP022291:2152246-2152284 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|