Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1819345..1819525 | Replicon | chromosome |
| Accession | NZ_CP022291 | ||
| Organism | Staphylococcus aureus strain EDCC5464 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CFN13_RS14155 | Protein ID | WP_001801861.1 |
| Coordinates | 1819345..1819440 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1819468..1819525 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFN13_RS08900 | 1814801..1815370 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CFN13_RS08905 | 1815606..1816841 | + | 1236 | WP_001215400.1 | IS21 family transposase | - |
| CFN13_RS08910 | 1816853..1817620 | + | 768 | WP_001095317.1 | IS21-like element helper ATPase IstB | - |
| CFN13_RS08915 | 1817759..1817944 | - | 186 | WP_000809864.1 | hypothetical protein | - |
| CFN13_RS08920 | 1817946..1818122 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| CFN13_RS08925 | 1818133..1818516 | - | 384 | WP_000070809.1 | hypothetical protein | - |
| CFN13_RS14200 | 1818698..1818922 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
| CFN13_RS08935 | 1819096..1819200 | - | 105 | WP_001670380.1 | transposase | - |
| CFN13_RS14155 | 1819345..1819440 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1819468..1819525 | - | 58 | - | - | Antitoxin |
| CFN13_RS08940 | 1819563..1819664 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| CFN13_RS08945 | 1819642..1819814 | - | 173 | Protein_1692 | transposase | - |
| CFN13_RS08950 | 1820008..1820385 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| CFN13_RS08955 | 1820591..1821031 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| CFN13_RS08960 | 1821076..1822689 | + | 1614 | WP_000926708.1 | lipase | - |
| CFN13_RS08965 | 1822704..1823003 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| CFN13_RS08970 | 1823318..1824478 | - | 1161 | WP_050961857.1 | phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1810364..1835751 | 25387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T78840 WP_001801861.1 NZ_CP022291:1819345-1819440 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T78840 NZ_CP022291:1819345-1819440 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT78840 NZ_CP022291:c1819525-1819468 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|