Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2530521..2530705 | Replicon | chromosome |
Accession | NZ_CP022290 | ||
Organism | Staphylococcus aureus strain EDCC5458 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | CFN12_RS13385 | Protein ID | WP_000482650.1 |
Coordinates | 2530598..2530705 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2530521..2530581 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFN12_RS13360 | 2526051..2526218 | - | 168 | WP_001790576.1 | hypothetical protein | - |
CFN12_RS13370 | 2526449..2528182 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
CFN12_RS13375 | 2528207..2529970 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2530521..2530581 | + | 61 | - | - | Antitoxin |
CFN12_RS13385 | 2530598..2530705 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CFN12_RS13390 | 2530839..2531225 | - | 387 | WP_000779358.1 | flippase GtxA | - |
CFN12_RS13395 | 2531493..2532635 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
CFN12_RS13400 | 2532695..2533354 | + | 660 | WP_000831298.1 | membrane protein | - |
CFN12_RS13405 | 2533536..2534747 | + | 1212 | WP_001192076.1 | multidrug effflux MFS transporter | - |
CFN12_RS13410 | 2534870..2535343 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T78836 WP_000482650.1 NZ_CP022290:c2530705-2530598 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T78836 NZ_CP022290:c2530705-2530598 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT78836 NZ_CP022290:2530521-2530581 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|