Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2065074..2065373 | Replicon | chromosome |
Accession | NZ_CP022290 | ||
Organism | Staphylococcus aureus strain EDCC5458 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CFN12_RS10790 | Protein ID | WP_011447039.1 |
Coordinates | 2065197..2065373 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2065074..2065129 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFN12_RS10730 | 2060633..2060812 | + | 180 | WP_000669789.1 | hypothetical protein | - |
CFN12_RS10740 | 2061123..2061383 | + | 261 | WP_001791826.1 | hypothetical protein | - |
CFN12_RS10745 | 2061435..2061785 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
CFN12_RS10750 | 2062296..2062631 | - | 336 | Protein_1987 | SH3 domain-containing protein | - |
CFN12_RS10770 | 2063282..2063773 | - | 492 | WP_031865878.1 | staphylokinase | - |
CFN12_RS10775 | 2063964..2064719 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CFN12_RS10780 | 2064731..2064985 | - | 255 | WP_000611512.1 | phage holin | - |
CFN12_RS10785 | 2065037..2065144 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2065066..2065205 | + | 140 | NuclAT_0 | - | - |
- | 2065066..2065205 | + | 140 | NuclAT_0 | - | - |
- | 2065066..2065205 | + | 140 | NuclAT_0 | - | - |
- | 2065066..2065205 | + | 140 | NuclAT_0 | - | - |
- | 2065074..2065129 | + | 56 | - | - | Antitoxin |
CFN12_RS10790 | 2065197..2065373 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CFN12_RS10795 | 2065523..2065819 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CFN12_RS10800 | 2065877..2066164 | - | 288 | WP_100183668.1 | hypothetical protein | - |
CFN12_RS10805 | 2066211..2066363 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CFN12_RS10810 | 2066353..2070138 | - | 3786 | WP_000582158.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2061435..2117064 | 55629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T78827 WP_011447039.1 NZ_CP022290:c2065373-2065197 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T78827 NZ_CP022290:c2065373-2065197 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT78827 NZ_CP022290:2065074-2065129 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|