Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1906488..1906670 | Replicon | chromosome |
| Accession | NZ_CP022290 | ||
| Organism | Staphylococcus aureus strain EDCC5458 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CFN12_RS14995 | Protein ID | WP_001801861.1 |
| Coordinates | 1906488..1906583 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1906611..1906670 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFN12_RS09690 | 1902148..1902774 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| CFN12_RS09695 | 1902815..1903159 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| CFN12_RS09700 | 1903257..1903808 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| CFN12_RS09705 | 1904026..1904667 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CFN12_RS09710 | 1904781..1904966 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| CFN12_RS09715 | 1904968..1905144 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| CFN12_RS09720 | 1905155..1905538 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| CFN12_RS09730 | 1906142..1906285 | - | 144 | WP_001549059.1 | transposase | - |
| CFN12_RS14995 | 1906488..1906583 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1906611..1906670 | - | 60 | - | - | Antitoxin |
| CFN12_RS09740 | 1906706..1906807 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| CFN12_RS09745 | 1906785..1906961 | - | 177 | Protein_1839 | transposase | - |
| CFN12_RS09750 | 1907155..1907532 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1880462..1938017 | 57555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T78824 WP_001801861.1 NZ_CP022290:1906488-1906583 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T78824 NZ_CP022290:1906488-1906583 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT78824 NZ_CP022290:c1906670-1906611 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|