Detailed information of TA system TA078712

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4265111..4265332
• Replicon: chromosome
• Accession: NZ_CP022229
• Organism: Escherichia coli strain WCHEC96200

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A229AEQ8
• Locus tag: DBR04_RS22725
• Protein ID: WP_000176713.1
• Coordinates: 4265111..4265218 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4265266..4265332 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DBR04_RS22695	4260245..4261327	+	1083	WP_000804726.1	peptide chain release factor 1	-
DBR04_RS22700	4261327..4262160	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
DBR04_RS22705	4262157..4262549	+	393	WP_000200377.1	invasion regulator SirB2	-
DBR04_RS22710	4262553..4263362	+	810	WP_001257044.1	invasion regulator SirB1	-
DBR04_RS22715	4263398..4264252	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
DBR04_RS22720	4264447..4264905	+	459	WP_000526135.1	IS200/IS605 family transposase	-
DBR04_RS22725	4265111..4265218	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4265266..4265332	+	67	NuclAT_20	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_20	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_20	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_20	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_25	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_25	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_25	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_25	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_30	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_30	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_30	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_30	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_35	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_35	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_35	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_35	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_37	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_37	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_37	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_37	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_42	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_42	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_42	-	Antitoxin
-	4265266..4265332	+	67	NuclAT_42	-	Antitoxin
-	4265268..4265331	+	64	NuclAT_45	-	-
-	4265268..4265331	+	64	NuclAT_45	-	-
-	4265268..4265331	+	64	NuclAT_45	-	-
-	4265268..4265331	+	64	NuclAT_45	-	-
-	4265268..4265331	+	64	NuclAT_47	-	-
-	4265268..4265331	+	64	NuclAT_47	-	-
-	4265268..4265331	+	64	NuclAT_47	-	-
-	4265268..4265331	+	64	NuclAT_47	-	-
-	4265268..4265331	+	64	NuclAT_49	-	-
-	4265268..4265331	+	64	NuclAT_49	-	-
-	4265268..4265331	+	64	NuclAT_49	-	-
-	4265268..4265331	+	64	NuclAT_49	-	-
DBR04_RS22735	4265646..4265753	-	108	WP_000170955.1	small toxic polypeptide LdrA/LdrC	-
-	4265806..4265867	+	62	NuclAT_44	-	-
-	4265806..4265867	+	62	NuclAT_44	-	-
-	4265806..4265867	+	62	NuclAT_44	-	-
-	4265806..4265867	+	62	NuclAT_44	-	-
-	4265806..4265867	+	62	NuclAT_46	-	-
-	4265806..4265867	+	62	NuclAT_46	-	-
-	4265806..4265867	+	62	NuclAT_46	-	-
-	4265806..4265867	+	62	NuclAT_46	-	-
-	4265806..4265867	+	62	NuclAT_48	-	-
-	4265806..4265867	+	62	NuclAT_48	-	-
-	4265806..4265867	+	62	NuclAT_48	-	-
-	4265806..4265867	+	62	NuclAT_48	-	-
-	4265806..4265868	+	63	NuclAT_21	-	-
-	4265806..4265868	+	63	NuclAT_21	-	-
-	4265806..4265868	+	63	NuclAT_21	-	-
-	4265806..4265868	+	63	NuclAT_21	-	-
-	4265806..4265868	+	63	NuclAT_26	-	-
-	4265806..4265868	+	63	NuclAT_26	-	-
-	4265806..4265868	+	63	NuclAT_26	-	-
-	4265806..4265868	+	63	NuclAT_26	-	-
-	4265806..4265868	+	63	NuclAT_31	-	-
-	4265806..4265868	+	63	NuclAT_31	-	-
-	4265806..4265868	+	63	NuclAT_31	-	-
-	4265806..4265868	+	63	NuclAT_31	-	-
-	4265806..4265868	+	63	NuclAT_36	-	-
-	4265806..4265868	+	63	NuclAT_36	-	-
-	4265806..4265868	+	63	NuclAT_36	-	-
-	4265806..4265868	+	63	NuclAT_36	-	-
-	4265806..4265868	+	63	NuclAT_38	-	-
-	4265806..4265868	+	63	NuclAT_38	-	-
-	4265806..4265868	+	63	NuclAT_38	-	-
-	4265806..4265868	+	63	NuclAT_38	-	-
-	4265806..4265868	+	63	NuclAT_43	-	-
-	4265806..4265868	+	63	NuclAT_43	-	-
-	4265806..4265868	+	63	NuclAT_43	-	-
-	4265806..4265868	+	63	NuclAT_43	-	-
DBR04_RS22745	4266159..4267259	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
DBR04_RS22750	4267529..4267759	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
DBR04_RS22755	4267917..4268612	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
DBR04_RS22760	4268656..4269009	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	4264447..4264905	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T78712 WP_000176713.1 NZ_CP022229:c4265218-4265111 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T78712 NZ_CP022229:c4265218-4265111 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT78712 NZ_CP022229:4265266-4265332 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A229AEQ8

Antitoxin