Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4265111..4265332 Replicon chromosome
Accession NZ_CP022229
Organism Escherichia coli strain WCHEC96200

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag DBR04_RS22725 Protein ID WP_000176713.1
Coordinates 4265111..4265218 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4265266..4265332 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR04_RS22695 4260245..4261327 + 1083 WP_000804726.1 peptide chain release factor 1 -
DBR04_RS22700 4261327..4262160 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
DBR04_RS22705 4262157..4262549 + 393 WP_000200377.1 invasion regulator SirB2 -
DBR04_RS22710 4262553..4263362 + 810 WP_001257044.1 invasion regulator SirB1 -
DBR04_RS22715 4263398..4264252 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DBR04_RS22720 4264447..4264905 + 459 WP_000526135.1 IS200/IS605 family transposase -
DBR04_RS22725 4265111..4265218 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4265266..4265332 + 67 NuclAT_20 - Antitoxin
- 4265266..4265332 + 67 NuclAT_20 - Antitoxin
- 4265266..4265332 + 67 NuclAT_20 - Antitoxin
- 4265266..4265332 + 67 NuclAT_20 - Antitoxin
- 4265266..4265332 + 67 NuclAT_25 - Antitoxin
- 4265266..4265332 + 67 NuclAT_25 - Antitoxin
- 4265266..4265332 + 67 NuclAT_25 - Antitoxin
- 4265266..4265332 + 67 NuclAT_25 - Antitoxin
- 4265266..4265332 + 67 NuclAT_30 - Antitoxin
- 4265266..4265332 + 67 NuclAT_30 - Antitoxin
- 4265266..4265332 + 67 NuclAT_30 - Antitoxin
- 4265266..4265332 + 67 NuclAT_30 - Antitoxin
- 4265266..4265332 + 67 NuclAT_35 - Antitoxin
- 4265266..4265332 + 67 NuclAT_35 - Antitoxin
- 4265266..4265332 + 67 NuclAT_35 - Antitoxin
- 4265266..4265332 + 67 NuclAT_35 - Antitoxin
- 4265266..4265332 + 67 NuclAT_37 - Antitoxin
- 4265266..4265332 + 67 NuclAT_37 - Antitoxin
- 4265266..4265332 + 67 NuclAT_37 - Antitoxin
- 4265266..4265332 + 67 NuclAT_37 - Antitoxin
- 4265266..4265332 + 67 NuclAT_42 - Antitoxin
- 4265266..4265332 + 67 NuclAT_42 - Antitoxin
- 4265266..4265332 + 67 NuclAT_42 - Antitoxin
- 4265266..4265332 + 67 NuclAT_42 - Antitoxin
- 4265268..4265331 + 64 NuclAT_45 - -
- 4265268..4265331 + 64 NuclAT_45 - -
- 4265268..4265331 + 64 NuclAT_45 - -
- 4265268..4265331 + 64 NuclAT_45 - -
- 4265268..4265331 + 64 NuclAT_47 - -
- 4265268..4265331 + 64 NuclAT_47 - -
- 4265268..4265331 + 64 NuclAT_47 - -
- 4265268..4265331 + 64 NuclAT_47 - -
- 4265268..4265331 + 64 NuclAT_49 - -
- 4265268..4265331 + 64 NuclAT_49 - -
- 4265268..4265331 + 64 NuclAT_49 - -
- 4265268..4265331 + 64 NuclAT_49 - -
DBR04_RS22735 4265646..4265753 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4265806..4265867 + 62 NuclAT_44 - -
- 4265806..4265867 + 62 NuclAT_44 - -
- 4265806..4265867 + 62 NuclAT_44 - -
- 4265806..4265867 + 62 NuclAT_44 - -
- 4265806..4265867 + 62 NuclAT_46 - -
- 4265806..4265867 + 62 NuclAT_46 - -
- 4265806..4265867 + 62 NuclAT_46 - -
- 4265806..4265867 + 62 NuclAT_46 - -
- 4265806..4265867 + 62 NuclAT_48 - -
- 4265806..4265867 + 62 NuclAT_48 - -
- 4265806..4265867 + 62 NuclAT_48 - -
- 4265806..4265867 + 62 NuclAT_48 - -
- 4265806..4265868 + 63 NuclAT_21 - -
- 4265806..4265868 + 63 NuclAT_21 - -
- 4265806..4265868 + 63 NuclAT_21 - -
- 4265806..4265868 + 63 NuclAT_21 - -
- 4265806..4265868 + 63 NuclAT_26 - -
- 4265806..4265868 + 63 NuclAT_26 - -
- 4265806..4265868 + 63 NuclAT_26 - -
- 4265806..4265868 + 63 NuclAT_26 - -
- 4265806..4265868 + 63 NuclAT_31 - -
- 4265806..4265868 + 63 NuclAT_31 - -
- 4265806..4265868 + 63 NuclAT_31 - -
- 4265806..4265868 + 63 NuclAT_31 - -
- 4265806..4265868 + 63 NuclAT_36 - -
- 4265806..4265868 + 63 NuclAT_36 - -
- 4265806..4265868 + 63 NuclAT_36 - -
- 4265806..4265868 + 63 NuclAT_36 - -
- 4265806..4265868 + 63 NuclAT_38 - -
- 4265806..4265868 + 63 NuclAT_38 - -
- 4265806..4265868 + 63 NuclAT_38 - -
- 4265806..4265868 + 63 NuclAT_38 - -
- 4265806..4265868 + 63 NuclAT_43 - -
- 4265806..4265868 + 63 NuclAT_43 - -
- 4265806..4265868 + 63 NuclAT_43 - -
- 4265806..4265868 + 63 NuclAT_43 - -
DBR04_RS22745 4266159..4267259 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
DBR04_RS22750 4267529..4267759 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DBR04_RS22755 4267917..4268612 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
DBR04_RS22760 4268656..4269009 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4264447..4264905 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T78712 WP_000176713.1 NZ_CP022229:c4265218-4265111 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T78712 NZ_CP022229:c4265218-4265111 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT78712 NZ_CP022229:4265266-4265332 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References