Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2943..3091 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP022092 | ||
| Organism | Staphylococcus saprophyticus strain FDAARGOS_355 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | CEQ33_RS12985 | Protein ID | WP_011276848.1 |
| Coordinates | 2943..3038 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 3056..3091 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CEQ33_RS13045 | 332..469 | + | 138 | WP_021459086.1 | hypothetical protein | - |
| CEQ33_RS13050 | 543..710 | - | 168 | WP_162837505.1 | hypothetical protein | - |
| CEQ33_RS00240 | 741..971 | - | 231 | WP_031884148.1 | SHOCT domain-containing protein | - |
| CEQ33_RS13055 | 1105..1305 | - | 201 | WP_073346352.1 | hypothetical protein | - |
| CEQ33_RS00250 | 1794..2411 | + | 618 | WP_002467537.1 | CadD family cadmium resistance transporter | - |
| CEQ33_RS00255 | 2430..2777 | + | 348 | WP_002467551.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| CEQ33_RS12985 | 2943..3038 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 3056..3091 | + | 36 | NuclAT_0 | - | Antitoxin |
| CEQ33_RS00260 | 3393..3866 | + | 474 | WP_077460978.1 | thymidylate synthase | - |
| CEQ33_RS00265 | 3980..4408 | + | 429 | WP_031885498.1 | Rrf2 family transcriptional regulator | - |
| CEQ33_RS00270 | 4529..5104 | + | 576 | Protein_10 | DsbA family protein | - |
| CEQ33_RS00275 | 5121..5771 | + | 651 | WP_031885497.1 | NAD(P)-dependent oxidoreductase | - |
| CEQ33_RS00280 | 6070..6825 | - | 756 | WP_031863945.1 | sulfite exporter TauE/SafE family protein | - |
| CEQ33_RS00285 | 6825..7085 | - | 261 | WP_031863946.1 | persulfide-sensing transcriptional repressor CstR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..38554 | 38554 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T78409 WP_011276848.1 NZ_CP022092:2943-3038 [Staphylococcus saprophyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T78409 NZ_CP022092:2943-3038 [Staphylococcus saprophyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT78409 NZ_CP022092:3056-3091 [Staphylococcus saprophyticus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|