Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 479298..479455 | Replicon | chromosome |
| Accession | NZ_CP022056 | ||
| Organism | Staphylococcus saprophyticus strain FDAARGOS_336 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CEQ14_RS12955 | Protein ID | WP_002441941.1 |
| Coordinates | 479360..479455 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 479298..479331 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CEQ14_RS02535 | 475085..475918 | + | 834 | WP_069795225.1 | aldo/keto reductase | - |
| CEQ14_RS02540 | 476385..476684 | - | 300 | WP_011304021.1 | hypothetical protein | - |
| CEQ14_RS02545 | 477061..477294 | + | 234 | WP_047505119.1 | ferrous iron transport protein A | - |
| CEQ14_RS12950 | 477355..477420 | - | 66 | WP_162009580.1 | type I toxin-antitoxin system Fst family toxin | - |
| CEQ14_RS02550 | 477608..479002 | - | 1395 | WP_069795224.1 | RES family NAD+ phosphorylase | - |
| - | 479298..479331 | + | 34 | - | - | Antitoxin |
| CEQ14_RS12955 | 479360..479455 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CEQ14_RS02555 | 479758..480516 | - | 759 | WP_069795223.1 | MerR family transcriptional regulator | - |
| CEQ14_RS02560 | 480626..481189 | - | 564 | WP_047505113.1 | helix-turn-helix domain-containing protein | - |
| CEQ14_RS02565 | 481383..482840 | - | 1458 | WP_063488860.1 | carbon starvation protein A | - |
| CEQ14_RS02570 | 483048..483887 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T78304 WP_002441941.1 NZ_CP022056:c479455-479360 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T78304 NZ_CP022056:c479455-479360 [Staphylococcus saprophyticus]
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
Antitoxin
Download Length: 34 bp
>AT78304 NZ_CP022056:479298-479331 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|