Detailed information of TA system TA078295

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 5246287..5246512
• Replicon: chromosome
• Accession: NZ_CP022050
• Organism: Escherichia coli O157 strain FDAARGOS_293

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: CEP72_RS27865
• Protein ID: WP_000813254.1
• Coordinates: 5246287..5246442 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	5246454..5246512 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CEP72_RS31095	5241745..5241876	-	132	WP_001344632.1	DUF3927 family protein	-
CEP72_RS27825	5241873..5242235	-	363	Protein_5056	tellurite resistance TerB family protein	-
CEP72_RS27830	5242473..5243294	-	822	WP_033803818.1	antitermination protein	-
CEP72_RS27835	5243291..5243665	-	375	WP_001121082.1	RusA family crossover junction endodeoxyribonuclease	-
CEP72_RS27840	5243678..5244727	-	1050	WP_001415191.1	DUF968 domain-containing protein	-
CEP72_RS27845	5244729..5244998	-	270	WP_012817785.1	hypothetical protein	-
CEP72_RS27850	5245052..5245279	-	228	WP_001452497.1	hypothetical protein	-
CEP72_RS27855	5245503..5245874	+	372	WP_001217944.1	type II toxin-antitoxin system RelE/ParE family toxin	-
CEP72_RS27860	5245867..5246184	+	318	WP_000042395.1	DNA-binding transcriptional regulator	-
CEP72_RS27865	5246287..5246442	-	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
-	5246454..5246512	+	59	-	-	Antitoxin
CEP72_RS27875	5246688..5246792	-	105	WP_001278450.1	hypothetical protein	-
CEP72_RS27880	5246908..5247621	-	714	WP_000555106.1	DUF551 domain-containing protein	-
CEP72_RS27885	5247822..5248034	-	213	WP_000063625.1	hypothetical protein	-
CEP72_RS27890	5248083..5248439	-	357	WP_000403779.1	hypothetical protein	-
CEP72_RS27895	5248417..5249136	-	720	WP_001289350.1	ead/Ea22-like family protein	-
CEP72_RS31355	5249133..5249309	-	177	WP_000753069.1	hypothetical protein	-
CEP72_RS27900	5249302..5249484	-	183	WP_001224662.1	hypothetical protein	-
CEP72_RS27905	5249518..5249730	-	213	WP_000935422.1	hypothetical protein	-
CEP72_RS27910	5249781..5250137	-	357	WP_000403783.1	hypothetical protein	-
CEP72_RS27915	5250115..5250490	-	376	Protein_5074	ead/Ea22-like family protein	-
CEP72_RS27920	5250487..5250783	-	297	WP_001266133.1	DUF4406 domain-containing protein	-
CEP72_RS27925	5250780..5251172	-	393	WP_001141097.1	DUF977 family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	nleC / nleG7'	5211212..5311334	100122

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T78295 WP_000813254.1 NZ_CP022050:c5246442-5246287 [Escherichia coli O157]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

>T78295 NZ_CP022050:c5246442-5246287 [Escherichia coli O157]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA

Antitoxin

Nucleotide

• Length: 59 bp

>AT78295 NZ_CP022050:5246454-5246512 [Escherichia coli O157]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin