Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4839275..4839500 | Replicon | chromosome |
| Accession | NZ_CP022050 | ||
| Organism | Escherichia coli O157 strain FDAARGOS_293 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | CEP72_RS25685 | Protein ID | WP_000813254.1 |
| Coordinates | 4839345..4839500 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4839275..4839333 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CEP72_RS25640 | 4834426..4834833 | - | 408 | WP_001003379.1 | helix-turn-helix domain-containing protein | - |
| CEP72_RS25645 | 4834911..4835138 | + | 228 | WP_000476986.1 | transcriptional regulator | - |
| CEP72_RS25650 | 4835122..4835673 | + | 552 | WP_000705378.1 | hypothetical protein | - |
| CEP72_RS31000 | 4835645..4836685 | + | 1041 | WP_000020565.1 | DNA-binding protein | - |
| CEP72_RS31005 | 4836597..4837139 | + | 543 | WP_157837342.1 | replication protein | - |
| CEP72_RS25660 | 4837174..4837932 | + | 759 | WP_000537579.1 | DUF1627 domain-containing protein | - |
| CEP72_RS25665 | 4837992..4838177 | + | 186 | WP_000215514.1 | hypothetical protein | - |
| CEP72_RS25675 | 4838525..4839073 | + | 549 | WP_000211435.1 | ORF6N domain-containing protein | - |
| - | 4839275..4839333 | - | 59 | - | - | Antitoxin |
| CEP72_RS25685 | 4839345..4839500 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| CEP72_RS25690 | 4839603..4839920 | - | 318 | WP_000042395.1 | DNA-binding transcriptional regulator | - |
| CEP72_RS25695 | 4839913..4840284 | - | 372 | WP_001217944.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CEP72_RS25700 | 4840508..4840735 | + | 228 | WP_001452497.1 | hypothetical protein | - |
| CEP72_RS25705 | 4840789..4841058 | + | 270 | WP_024177817.1 | hypothetical protein | - |
| CEP72_RS25710 | 4841060..4842109 | + | 1050 | WP_088592046.1 | DUF968 domain-containing protein | - |
| CEP72_RS25715 | 4842122..4842496 | + | 375 | WP_000904171.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CEP72_RS25720 | 4842493..4843314 | + | 822 | WP_000762902.1 | antitermination protein | - |
| CEP72_RS25725 | 4843541..4843738 | + | 198 | WP_000917735.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | paa / nleA/espI / nleH2 / nleF / espM1 / ospG | 4765563..4875390 | 109827 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T78290 WP_000813254.1 NZ_CP022050:4839345-4839500 [Escherichia coli O157]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T78290 NZ_CP022050:4839345-4839500 [Escherichia coli O157]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATTGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATTGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT78290 NZ_CP022050:c4839333-4839275 [Escherichia coli O157]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|