Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4725383..4725597 Replicon chromosome
Accession NZ_CP022050
Organism Escherichia coli O157 strain FDAARGOS_293

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag CEP72_RS24970 Protein ID WP_000170963.1
Coordinates 4725383..4725490 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4725538..4725597 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CEP72_RS24940 4720692..4721774 + 1083 WP_000804726.1 peptide chain release factor 1 -
CEP72_RS24945 4721774..4722607 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
CEP72_RS24950 4722604..4722996 + 393 WP_000200379.1 invasion regulator SirB2 -
CEP72_RS24955 4723000..4723809 + 810 WP_001257044.1 invasion regulator SirB1 -
CEP72_RS24960 4723845..4724699 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
CEP72_RS24965 4724847..4724954 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4725007..4725068 + 62 NuclAT_24 - -
- 4725007..4725068 + 62 NuclAT_24 - -
- 4725007..4725068 + 62 NuclAT_24 - -
- 4725007..4725068 + 62 NuclAT_24 - -
- 4725007..4725068 + 62 NuclAT_26 - -
- 4725007..4725068 + 62 NuclAT_26 - -
- 4725007..4725068 + 62 NuclAT_26 - -
- 4725007..4725068 + 62 NuclAT_26 - -
- 4725007..4725068 + 62 NuclAT_28 - -
- 4725007..4725068 + 62 NuclAT_28 - -
- 4725007..4725068 + 62 NuclAT_28 - -
- 4725007..4725068 + 62 NuclAT_28 - -
- 4725007..4725068 + 62 NuclAT_30 - -
- 4725007..4725068 + 62 NuclAT_30 - -
- 4725007..4725068 + 62 NuclAT_30 - -
- 4725007..4725068 + 62 NuclAT_30 - -
- 4725007..4725068 + 62 NuclAT_32 - -
- 4725007..4725068 + 62 NuclAT_32 - -
- 4725007..4725068 + 62 NuclAT_32 - -
- 4725007..4725068 + 62 NuclAT_32 - -
- 4725007..4725069 + 63 NuclAT_17 - -
- 4725007..4725069 + 63 NuclAT_17 - -
- 4725007..4725069 + 63 NuclAT_17 - -
- 4725007..4725069 + 63 NuclAT_17 - -
- 4725007..4725069 + 63 NuclAT_18 - -
- 4725007..4725069 + 63 NuclAT_18 - -
- 4725007..4725069 + 63 NuclAT_18 - -
- 4725007..4725069 + 63 NuclAT_18 - -
- 4725007..4725069 + 63 NuclAT_19 - -
- 4725007..4725069 + 63 NuclAT_19 - -
- 4725007..4725069 + 63 NuclAT_19 - -
- 4725007..4725069 + 63 NuclAT_19 - -
- 4725007..4725069 + 63 NuclAT_20 - -
- 4725007..4725069 + 63 NuclAT_20 - -
- 4725007..4725069 + 63 NuclAT_20 - -
- 4725007..4725069 + 63 NuclAT_20 - -
- 4725007..4725069 + 63 NuclAT_22 - -
- 4725007..4725069 + 63 NuclAT_22 - -
- 4725007..4725069 + 63 NuclAT_22 - -
- 4725007..4725069 + 63 NuclAT_22 - -
- 4725007..4725069 + 63 NuclAT_23 - -
- 4725007..4725069 + 63 NuclAT_23 - -
- 4725007..4725069 + 63 NuclAT_23 - -
- 4725007..4725069 + 63 NuclAT_23 - -
CEP72_RS24970 4725383..4725490 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 4725538..4725597 + 60 NuclAT_25 - Antitoxin
- 4725538..4725597 + 60 NuclAT_25 - Antitoxin
- 4725538..4725597 + 60 NuclAT_25 - Antitoxin
- 4725538..4725597 + 60 NuclAT_25 - Antitoxin
- 4725538..4725597 + 60 NuclAT_27 - Antitoxin
- 4725538..4725597 + 60 NuclAT_27 - Antitoxin
- 4725538..4725597 + 60 NuclAT_27 - Antitoxin
- 4725538..4725597 + 60 NuclAT_27 - Antitoxin
- 4725538..4725597 + 60 NuclAT_29 - Antitoxin
- 4725538..4725597 + 60 NuclAT_29 - Antitoxin
- 4725538..4725597 + 60 NuclAT_29 - Antitoxin
- 4725538..4725597 + 60 NuclAT_29 - Antitoxin
- 4725538..4725597 + 60 NuclAT_31 - Antitoxin
- 4725538..4725597 + 60 NuclAT_31 - Antitoxin
- 4725538..4725597 + 60 NuclAT_31 - Antitoxin
- 4725538..4725597 + 60 NuclAT_31 - Antitoxin
- 4725538..4725597 + 60 NuclAT_33 - Antitoxin
- 4725538..4725597 + 60 NuclAT_33 - Antitoxin
- 4725538..4725597 + 60 NuclAT_33 - Antitoxin
- 4725538..4725597 + 60 NuclAT_33 - Antitoxin
CEP72_RS24975 4725889..4726989 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
CEP72_RS24980 4727259..4727489 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CEP72_RS24985 4727650..4728345 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
CEP72_RS24990 4728389..4728742 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CEP72_RS24995 4728928..4730322 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T78288 WP_000170963.1 NZ_CP022050:c4725490-4725383 [Escherichia coli O157]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T78288 NZ_CP022050:c4725490-4725383 [Escherichia coli O157]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT78288 NZ_CP022050:4725538-4725597 [Escherichia coli O157]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References