Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 491296..491521 | Replicon | chromosome |
Accession | NZ_CP022050 | ||
Organism | Escherichia coli O157 strain FDAARGOS_293 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | CEP72_RS02955 | Protein ID | WP_000813263.1 |
Coordinates | 491296..491451 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 491463..491521 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CEP72_RS30585 | 486750..487463 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
CEP72_RS02925 | 487601..487797 | - | 197 | Protein_520 | TrmB family transcriptional regulator | - |
CEP72_RS02930 | 488084..488902 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
CEP72_RS02935 | 489054..489425 | - | 372 | WP_000090264.1 | antitermination protein | - |
CEP72_RS02940 | 489415..489786 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
CEP72_RS02945 | 489799..490848 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
CEP72_RS02950 | 490850..491128 | - | 279 | WP_001341388.1 | hypothetical protein | - |
CEP72_RS02955 | 491296..491451 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 491463..491521 | + | 59 | - | - | Antitoxin |
CEP72_RS02960 | 492056..492829 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
CEP72_RS02965 | 493181..493594 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
CEP72_RS02970 | 493610..494380 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
CEP72_RS02975 | 494402..495148 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
CEP72_RS02980 | 495155..496246 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T78262 WP_000813263.1 NZ_CP022050:c491451-491296 [Escherichia coli O157]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T78262 NZ_CP022050:c491451-491296 [Escherichia coli O157]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT78262 NZ_CP022050:491463-491521 [Escherichia coli O157]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|