Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
Location | 1931532..1931825 | Replicon | chromosome |
Accession | NZ_CP021911 | ||
Organism | Bacillus sp. MD-5 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | - |
Locus tag | CDO84_RS21365 | Protein ID | WP_052438156.1 |
Coordinates | 1931532..1931648 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 1931643..1931825 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDO84_RS21355 | 1926840..1926981 | + | 142 | Protein_1797 | phage holin | - |
CDO84_RS09290 | 1927135..1928250 | + | 1116 | Protein_1798 | response regulator aspartate phosphatase RapK | - |
CDO84_RS09295 | 1928247..1928369 | + | 123 | WP_004399440.1 | phosphatase RapK inhibitor PhrK | - |
CDO84_RS21565 | 1928597..1929218 | - | 622 | Protein_1800 | DNA repair protein | - |
CDO84_RS09310 | 1929258..1929602 | - | 345 | Protein_1801 | UV damage repair protein UvrX | - |
CDO84_RS09315 | 1929650..1929919 | - | 270 | WP_040082935.1 | YolD-like family protein | - |
CDO84_RS09320 | 1930093..1930428 | + | 336 | WP_040082934.1 | hypothetical protein | - |
CDO84_RS09325 | 1930471..1930827 | - | 357 | WP_040082933.1 | hypothetical protein | - |
CDO84_RS09330 | 1930833..1931300 | - | 468 | WP_040082931.1 | YolA family protein | - |
CDO84_RS21365 | 1931532..1931648 | + | 117 | WP_052438156.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 1931643..1931825 | - | 183 | NuclAT_1 | - | Antitoxin |
- | 1931643..1931825 | - | 183 | NuclAT_1 | - | Antitoxin |
- | 1931643..1931825 | - | 183 | NuclAT_1 | - | Antitoxin |
- | 1931643..1931825 | - | 183 | NuclAT_1 | - | Antitoxin |
CDO84_RS09335 | 1931949..1932407 | - | 459 | WP_003231326.1 | type II toxin-antitoxin system antitoxin YobK | - |
CDO84_RS09340 | 1932417..1934219 | - | 1803 | WP_040082929.1 | type II toxin-antitoxin system toxin ribonuclease YobL | - |
CDO84_RS09345 | 1934428..1935888 | + | 1461 | WP_040082928.1 | hypothetical protein | - |
CDO84_RS09350 | 1935910..1936023 | + | 114 | Protein_1810 | excalibur calcium-binding domain-containing protein | - |
CDO84_RS09355 | 1936147..1936680 | - | 534 | WP_040082927.1 | N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1906825..1937605 | 30780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4322.37 Da Isoelectric Point: 10.1022
>T77863 WP_052438156.1 NZ_CP021911:1931532-1931648 [Bacillus sp. MD-5]
MTVYESLMVMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMVMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T77863 NZ_CP021911:1931532-1931648 [Bacillus sp. MD-5]
ATGACTGTTTACGAATCATTAATGGTAATGATCAATTTTGGCGGGTTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCGAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGGTAATGATCAATTTTGGCGGGTTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCGAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 183 bp
>AT77863 NZ_CP021911:c1931825-1931643 [Bacillus sp. MD-5]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATGAAATGCATAAAATAAAAAAGGTCAGGGTGCTACCAACA
CCCCGACTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAAATGCATGTGACATAGTAGATCAACCCCTTAGGGTCG
CAATCTCAAGGGGAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATGAAATGCATAAAATAAAAAAGGTCAGGGTGCTACCAACA
CCCCGACTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAAATGCATGTGACATAGTAGATCAACCCCTTAGGGTCG
CAATCTCAAGGGGAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|