Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2181496..2181693 | Replicon | chromosome |
Accession | NZ_CP021905 | ||
Organism | Staphylococcus aureus strain Seattle 1945 isolate G477 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | CD017_RS11165 | Protein ID | WP_073392962.1 |
Coordinates | 2181589..2181693 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2181496..2181534 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD017_RS11145 | 2177671..2178336 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
CD017_RS11150 | 2178488..2178808 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CD017_RS11155 | 2178810..2179790 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
CD017_RS11160 | 2180056..2181147 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
- | 2181496..2181534 | + | 39 | - | - | Antitoxin |
CD017_RS11165 | 2181589..2181693 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
CD017_RS11175 | 2182373..2182531 | + | 159 | WP_001792784.1 | hypothetical protein | - |
CD017_RS11185 | 2183190..2184047 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
CD017_RS11190 | 2184115..2184897 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T77841 WP_073392962.1 NZ_CP021905:c2181693-2181589 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T77841 NZ_CP021905:c2181693-2181589 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT77841 NZ_CP021905:2181496-2181534 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|