Detailed information of TA system TA077775

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 52331..52564
• Replicon: plasmid tig00001069_pilon
• Accession: NZ_CP021880
• Organism: Escherichia coli strain AR_0137

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: AM384_RS24700
• Protein ID: WP_001312861.1
• Coordinates: 52406..52564 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	52331..52362 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AM384_RS24650	47562..47768	+	207	WP_001774176.1	hypothetical protein	-
AM384_RS27155	48178..48384	+	207	WP_000275856.1	hypothetical protein	-
AM384_RS24670	48410..48949	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
AM384_RS24675	49017..49250	+	234	WP_000005990.1	DUF905 family protein	-
AM384_RS24680	49278..49475	+	198	Protein_56	hypothetical protein	-
AM384_RS24685	49530..49964	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
AM384_RS24690	49961..50680	+	720	WP_001276238.1	plasmid SOS inhibition protein A	-
AM384_RS26905	50692..50880	-	189	WP_001299721.1	hypothetical protein	-
-	50692..50889	+	198	NuclAT_0	-	-
-	50692..50889	+	198	NuclAT_0	-	-
-	50692..50889	+	198	NuclAT_0	-	-
-	50692..50889	+	198	NuclAT_0	-	-
AM384_RS24695	50937..52306	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	52331..52362	+	32	NuclAT_1	-	Antitoxin
-	52331..52362	+	32	NuclAT_1	-	Antitoxin
-	52331..52362	+	32	NuclAT_1	-	Antitoxin
-	52331..52362	+	32	NuclAT_1	-	Antitoxin
AM384_RS24700	52406..52564	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
AM384_RS24710	53485..53772	+	288	WP_000107535.1	hypothetical protein	-
AM384_RS24715	53890..54711	+	822	WP_001234426.1	DUF945 domain-containing protein	-
AM384_RS24720	55008..55610	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
AM384_RS24725	55931..56314	+	384	WP_001151524.1	relaxosome protein TraM	-
AM384_RS24730	56501..57190	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B)	iucA / iucB / iucC / iucD / iutA	1..169449	169449

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T77775 WP_001312861.1 NZ_CP021880:52406-52564 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T77775 NZ_CP021880:52406-52564 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 32 bp

>AT77775 NZ_CP021880:52331-52362 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin