Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 52331..52564 | Replicon | plasmid tig00001069_pilon |
| Accession | NZ_CP021880 | ||
| Organism | Escherichia coli strain AR_0137 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AM384_RS24700 | Protein ID | WP_001312861.1 |
| Coordinates | 52406..52564 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 52331..52362 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM384_RS24650 | 47562..47768 | + | 207 | WP_001774176.1 | hypothetical protein | - |
| AM384_RS27155 | 48178..48384 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| AM384_RS24670 | 48410..48949 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| AM384_RS24675 | 49017..49250 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| AM384_RS24680 | 49278..49475 | + | 198 | Protein_56 | hypothetical protein | - |
| AM384_RS24685 | 49530..49964 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| AM384_RS24690 | 49961..50680 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| AM384_RS26905 | 50692..50880 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 50692..50889 | + | 198 | NuclAT_0 | - | - |
| - | 50692..50889 | + | 198 | NuclAT_0 | - | - |
| - | 50692..50889 | + | 198 | NuclAT_0 | - | - |
| - | 50692..50889 | + | 198 | NuclAT_0 | - | - |
| AM384_RS24695 | 50937..52306 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 52331..52362 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 52331..52362 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 52331..52362 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 52331..52362 | + | 32 | NuclAT_1 | - | Antitoxin |
| AM384_RS24700 | 52406..52564 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AM384_RS24710 | 53485..53772 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| AM384_RS24715 | 53890..54711 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| AM384_RS24720 | 55008..55610 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| AM384_RS24725 | 55931..56314 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| AM384_RS24730 | 56501..57190 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B) | iucA / iucB / iucC / iucD / iutA | 1..169449 | 169449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T77775 WP_001312861.1 NZ_CP021880:52406-52564 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T77775 NZ_CP021880:52406-52564 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT77775 NZ_CP021880:52331-52362 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|