Detailed information of TA system TA077737

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 56272..56511
• Replicon: plasmid pH105
• Accession: NZ_CP021871
• Organism: Escherichia coli strain H105

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: CCL28_RS26135
• Protein ID: WP_023144756.1
• Coordinates: 56272..56406 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	56451..56511 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CCL28_RS26090	51619..52034	-	416	Protein_63	IS1 family transposase	-
CCL28_RS26100	52283..52684	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
CCL28_RS27005	52617..52874	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
CCL28_RS26105	52967..53620	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
CCL28_RS26115	54560..55417	-	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
CCL28_RS26120	55410..55484	-	75	WP_031943482.1	RepA leader peptide Tap	-
CCL28_RS27190	55481..55615	-	135	Protein_69	protein CopA/IncA	-
CCL28_RS26130	55721..55975	-	255	WP_000083850.1	replication regulatory protein RepA	-
CCL28_RS26135	56272..56406	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	56451..56511	+	61	NuclAT_2	-	Antitoxin
-	56451..56511	+	61	NuclAT_2	-	Antitoxin
-	56451..56511	+	61	NuclAT_2	-	Antitoxin
-	56451..56511	+	61	NuclAT_2	-	Antitoxin
CCL28_RS27195	56478..56764	-	287	Protein_72	DUF2726 domain-containing protein	-
CCL28_RS26145	56842..58455	-	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
CCL28_RS26150	58486..58836	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
CCL28_RS26155	58833..59258	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
CCL28_RS26165	59817..60029	-	213	WP_013023861.1	hypothetical protein	-
CCL28_RS26170	60160..60720	-	561	WP_000139341.1	fertility inhibition protein FinO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27	senB	1..134899	134899

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T77737 WP_023144756.1 NZ_CP021871:c56406-56272 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T77737 NZ_CP021871:c56406-56272 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT77737 NZ_CP021871:56451-56511 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin