Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 47486..47755 | Replicon | plasmid pEC1515-3 |
Accession | NZ_CP021847 | ||
Organism | Escherichia coli strain EC1515 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CDH89_RS27865 | Protein ID | WP_001312861.1 |
Coordinates | 47597..47755 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 47486..47551 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDH89_RS27840 | 43259..43786 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CDH89_RS27845 | 43842..44075 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CDH89_RS27850 | 44134..46098 | + | 1965 | WP_079976098.1 | ParB/RepB/Spo0J family partition protein | - |
CDH89_RS27855 | 46167..46601 | + | 435 | WP_000845894.1 | conjugation system SOS inhibitor PsiB | - |
CDH89_RS27860 | 46598..47317 | + | 720 | WP_000116352.1 | plasmid SOS inhibition protein A | - |
CDH89_RS28450 | 47329..47517 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 47329..47553 | + | 225 | NuclAT_1 | - | - |
- | 47329..47553 | + | 225 | NuclAT_1 | - | - |
- | 47329..47553 | + | 225 | NuclAT_1 | - | - |
- | 47329..47553 | + | 225 | NuclAT_1 | - | - |
- | 47486..47551 | + | 66 | - | - | Antitoxin |
CDH89_RS27865 | 47597..47755 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CDH89_RS28645 | 48446..48652 | + | 207 | WP_000547971.1 | hypothetical protein | - |
CDH89_RS27880 | 48677..48964 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CDH89_RS27885 | 49083..49904 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CDH89_RS27890 | 50201..50848 | - | 648 | WP_157698281.1 | transglycosylase SLT domain-containing protein | - |
CDH89_RS27895 | 51125..51508 | + | 384 | WP_000124979.1 | relaxosome protein TraM | - |
CDH89_RS27900 | 51699..52385 | + | 687 | WP_000332493.1 | PAS domain-containing protein | - |
CDH89_RS27905 | 52479..52706 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / ant(3'')-Ia / lnu(F) / sul3 | - | 1..84091 | 84091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T77661 WP_001312861.1 NZ_CP021847:47597-47755 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T77661 NZ_CP021847:47597-47755 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT77661 NZ_CP021847:47486-47551 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|