Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41910..42180 | Replicon | plasmid pEC1515-3 |
Accession | NZ_CP021847 | ||
Organism | Escherichia coli strain EC1515 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CDH89_RS27825 | Protein ID | WP_001312861.1 |
Coordinates | 42022..42180 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 41910..41973 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDH89_RS27780 | 36957..37211 | + | 255 | WP_071598075.1 | hypothetical protein | - |
CDH89_RS27800 | 37684..38211 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CDH89_RS27805 | 38267..38500 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CDH89_RS27810 | 38559..40523 | + | 1965 | WP_079976098.1 | ParB/RepB/Spo0J family partition protein | - |
CDH89_RS27815 | 40592..41026 | + | 435 | WP_000845894.1 | conjugation system SOS inhibitor PsiB | - |
CDH89_RS27820 | 41023..41742 | + | 720 | WP_000116352.1 | plasmid SOS inhibition protein A | - |
CDH89_RS28440 | 41754..41942 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 41754..41978 | + | 225 | NuclAT_0 | - | - |
- | 41754..41978 | + | 225 | NuclAT_0 | - | - |
- | 41754..41978 | + | 225 | NuclAT_0 | - | - |
- | 41754..41978 | + | 225 | NuclAT_0 | - | - |
- | 41910..41973 | - | 64 | - | - | Antitoxin |
CDH89_RS27825 | 42022..42180 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CDH89_RS28445 | 42475..42786 | + | 312 | WP_198320231.1 | hypothetical protein | - |
CDH89_RS27840 | 43259..43786 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CDH89_RS27845 | 43842..44075 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CDH89_RS27850 | 44134..46098 | + | 1965 | WP_079976098.1 | ParB/RepB/Spo0J family partition protein | - |
CDH89_RS27855 | 46167..46601 | + | 435 | WP_000845894.1 | conjugation system SOS inhibitor PsiB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / ant(3'')-Ia / lnu(F) / sul3 | - | 1..84091 | 84091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T77656 WP_001312861.1 NZ_CP021847:42022-42180 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T77656 NZ_CP021847:42022-42180 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT77656 NZ_CP021847:c41973-41910 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|