Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 28564..28828 | Replicon | plasmid pEC1515-1 |
Accession | NZ_CP021845 | ||
Organism | Escherichia coli strain EC1515 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | CDH89_RS26205 | Protein ID | WP_001387489.1 |
Coordinates | 28564..28716 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 28768..28828 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDH89_RS26180 | 23830..25998 | + | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
CDH89_RS26185 | 26069..26731 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CDH89_RS26190 | 26803..27012 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CDH89_RS28600 | 27404..27580 | + | 177 | WP_001054897.1 | hypothetical protein | - |
CDH89_RS26195 | 27645..27941 | - | 297 | WP_011264046.1 | hypothetical protein | - |
CDH89_RS26200 | 28241..28492 | + | 252 | WP_001291964.1 | hypothetical protein | - |
CDH89_RS26205 | 28564..28716 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- | 28768..28828 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 28768..28828 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 28768..28828 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 28768..28828 | + | 61 | NuclAT_0 | - | Antitoxin |
CDH89_RS28385 | 29031..29378 | + | 348 | Protein_31 | protein finQ | - |
CDH89_RS26215 | 29564..30826 | + | 1263 | WP_000608644.1 | IS1380-like element ISEc9 family transposase | - |
CDH89_RS26220 | 31150..32295 | + | 1146 | WP_015056382.1 | class C beta-lactamase CMY-4 | - |
CDH89_RS26225 | 32389..32922 | + | 534 | WP_001221666.1 | lipocalin family protein | - |
CDH89_RS26230 | 32919..33236 | - | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-4 / aac(3)-IId / ant(3'')-Ia | - | 1..125099 | 125099 | |
- | flank | IS/Tn | blaCMY-4 | - | 29564..32295 | 2731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T77650 WP_001387489.1 NZ_CP021845:c28716-28564 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T77650 NZ_CP021845:c28716-28564 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT77650 NZ_CP021845:28768-28828 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|